Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11676 PPIA CYPA Homo sapiens Yes Secreted Proteins

HuProt v2.0
Block Row Column Clone
32 16 9 JHU11676
32 16 10 JHU11676
HuProt v3.0
Block Row Column Clone
14 1 32 JHU11676
14 2 32 JHU11676
HuProt v3.1
Block Row Column Clone
14 1 32 JHU11676
14 2 32 JHU11676

External Database ID

Nucleotide (318bp)

>JHU11676
ATGTGTCAGGGTGGTGACTTCACACGCCATAATGGCACTGGTGGCAAGTCCATCTATGGGGAGAAATTTGAAGATGAGAA
CTTCATCCTAAAGCATACGGGTCCTGGCATCTTGTCCATGGCAAATGCTGGACCCAACACAAATGGTTCCCAGTTTTTCA
TCTGCACTGCCAAGACTGAGTGGTTGGATGGCAAGCATGTGGTGTTTGGCAAAGTGAAAGAAGGCATGAATATTGTGGAG
GCCATGGAGCGCTTTGGGTCCAGGAATGGCAAGACCAGCAAGAAGATCACCATTGCTGACTGTGGACAACTCGAATAG

Protein (105aa)

>JHU11676
MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVE
AMERFGSRNGKTSKKITIADCGQLE