Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11670 NME7 Homo sapiens Yes Kinases; Metabolism

HuProt v2.0
Block Row Column Clone
22 16 15 JHU11670
22 16 16 JHU11670
HuProt v3.0
Block Row Column Clone
13 5 9 JHU11670
13 6 9 JHU11670
HuProt v3.1
Block Row Column Clone
13 5 9 JHU11670
13 6 9 JHU11670

External Database ID

Nucleotide (1023bp)

>JHU11670
ATGCATGATGTAAAGAATCATCGCACCTTTTTAAAGCGGACCAAATATGATAACCTGCACTTGGAAGATTTATTTATAGG
CAACAAAGTGAATGTCTTCTCTCGACAACTGGTATTAATTGACTATGGGGATCAATATACAGCTCGCCAGCTGGGCAGTA
GGAAAGAAAAAACGCTAGCCCTAATTAAACCAGATGCAATATCAAAGGCTGGAGAAATAATTGAAATAATAAACAAAGCT
GGATTTACTATAACCAAACTCAAAATGATGATGCTTTCAAGGAAAGAAGCATTGGATTTTCATGTAGATCACCAGTCAAG
ACCCTTTTTCAATGAGCTGATCCAGTTTATTACAACTGGTCCTATTATTGCCATGGAGATTTTAAGAGATGATGCTATAT
GTGAATGGAAAAGACTGCTGGGACCTGCAAACTCTGGAGTGGCACGCACAGATGCTTCTGAAAGCATTAGAGCCCTCTTT
GGAACAGATGGCATAAGAAATGCAGCGCATGGCCCTGATTCTTTTGCTTCTGCGGCCAGAGAAATGGAGTTGTTTTTTCC
TTCAAGTGGAGGTTGTGGGCCGGCAAACACTGCTAAATTTACTAATTGTACCTGTTGCATTGTTAAACCCCATGCTGTCA
GTGAAGGACTGTTGGGAAAGATCCTGATGGCTATCCGAGATGCAGGTTTTGAAATCTCAGCTATGCAGATGTTCAATATG
GATCGGGTTAATGTTGAGGAATTCTATGAAGTTTATAAAGGAGTAGTGACCGAATATCATGACATGGTGACAGAAATGTA
TTCTGGCCCTTGTGTAGCAATGGAGATTCAACAGAATAATGCTACAAAGACATTTCGAGAATTTTGTGGACCTGCTGATC
CTGAAATTGCCCGGCATTTACGCCCTGGAACTCTCAGAGCAATCTTTGGTAAAACTAAGATCCAGAATGCTGTTCACTGT
ACTGATCTGCCAGAGGATGGCCTATTAGAGGTTCAATACTTCTTCAAGATCTTGGATAATTAG

Protein (340aa)

>JHU11670
MHDVKNHRTFLKRTKYDNLHLEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAISKAGEIIEIINKA
GFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITTGPIIAMEILRDDAICEWKRLLGPANSGVARTDASESIRALF
GTDGIRNAAHGPDSFASAAREMELFFPSSGGCGPANTAKFTNCTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNM
DRVNVEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHC
TDLPEDGLLEVQYFFKILDN