Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11665 MTERF3 MTERFD1 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
16 10 19 JHU11665
16 10 20 JHU11665
14 10 19 JHU11665
14 10 20 JHU11665
14 16 9 JHU11665
14 16 10 JHU11665
16 16 13 JHU11665
16 16 14 JHU11665
HuProt v3.0
Block Row Column Clone
8 57 32 JHU11665
8 58 32 JHU11665
8 57 27 JHU11665
8 58 27 JHU11665
14 1 29 JHU11665
14 2 29 JHU11665
13 1 14 JHU11665
13 2 14 JHU11665
HuProt v3.1
Block Row Column Clone
8 57 32 JHU11665
8 58 32 JHU11665
8 57 27 JHU11665
8 58 27 JHU11665
14 1 29 JHU11665
14 2 29 JHU11665
13 1 14 JHU11665
13 2 14 JHU11665

External Database ID

Nucleotide (1254bp)

>JHU11665
ATGGCTTTGTCAGCCCAACAGATACCCAGATGGTTTAACTCAGTTAAGTTGAGGAGCCTCATTAATGCTGCACAACTCAC
AAAACGTTTTACTAGACCAGCAAGAACACTGTTACATGGCTTTTCTGCTCAGCCTCAGATATCCTCTGACAATTGCTTTC
TCCAGTGGGGATTTAAGACTTACAGGACTTCCTCCTTATGGAATAGTTCCCAGTCTACTAGCTCAAGTAGTCAGGAGAAT
AATTCTGCCCAAAGCAGTCTGCTTCCTTCCATGAATGAACAGTCACAGAAGACACAAAATATATCCAGCTTTGATTCTGA
GCTGTTTCTAGAAGAACTGGATGAATTGCCTCCATTGTCTCCAATGCAGCCAATTTCAGAGGAAGAGGCTATTCAGATTA
TTGCAGACCCTCCATTGCCACCAGCTTCATTCACACTTCGAGACTATGTGGATCATTCTGAGACTCTGCAGAAGTTGGTT
CTTCTAGGCGTGGATTTGTCCAAGATAGAAAAACATCCAGAAGCAGCAAACCTCCTTCTGAGACTGGATTTTGAAAAAGA
CATTAAGCAAATGCTTCTGTTTCTTAAAGATGTGGGTATAGAGGATAACCAACTGGGAGCATTCCTGACAAAAAATCATG
CAATTTTCTCTGAAGACCTTGAAAATCTGAAGACCAGGGTGGCTTATCTGCATTCAAAAAATTTCAGTAAAGCAGATGTT
GCACAGATGGTCAGAAAAGCACCATTTTTGCTGAACTTTTCAGTGGAAAGACTGGATAACAGATTGGGATTTTTTCAGAA
AGAACTTGAACTTAGTGTGAAGAAGACTAGAGATCTGGTAGTTCGTCTCCCAAGGCTGCTAACTGGAAGTCTGGAACCCG
TGAAAGAAAATATGAAGGTTTATCGTCTTGAACTTGGTTTTAAACATAACGAAATTCAACATATGATCACCAGAATCCCA
AAGATGTTAACTGCAAATAAAATGAAACTTACCGAGACGTTTGATTTTGTGCACAATGTGATGAGCATTCCCCACCACAT
CATTGTCAAGTTCCCACAGGTATTTAATACAAGGCTGTTTAAGGTCAAAGAAAGACACTTGTTTCTTACCTATTTAGGAA
GAGCACAGTATGATCCAGCAAAACCTAACTACATCTCTTTGGACAAACTAGTATCTATTCCTGATGAAATATTTTGTGAA
GAGATTGCCAAAGCATCAGTACAGGACTTTGAAAAATTCTTAAAAACGCTTTAG

Protein (417aa)

>JHU11665
MALSAQQIPRWFNSVKLRSLINAAQLTKRFTRPARTLLHGFSAQPQISSDNCFLQWGFKTYRTSSLWNSSQSTSSSSQEN
NSAQSSLLPSMNEQSQKTQNISSFDSELFLEELDELPPLSPMQPISEEEAIQIIADPPLPPASFTLRDYVDHSETLQKLV
LLGVDLSKIEKHPEAANLLLRLDFEKDIKQMLLFLKDVGIEDNQLGAFLTKNHAIFSEDLENLKTRVAYLHSKNFSKADV
AQMVRKAPFLLNFSVERLDNRLGFFQKELELSVKKTRDLVVRLPRLLTGSLEPVKENMKVYRLELGFKHNEIQHMITRIP
KMLTANKMKLTETFDFVHNVMSIPHHIIVKFPQVFNTRLFKVKERHLFLTYLGRAQYDPAKPNYISLDKLVSIPDEIFCE
EIAKASVQDFEKFLKTL