Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11663 MRPL27 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
24 16 15 JHU11663
24 16 16 JHU11663
HuProt v3.0
Block Row Column Clone
13 5 8 JHU11663
13 6 8 JHU11663
HuProt v3.1
Block Row Column Clone
13 5 8 JHU11663
13 6 8 JHU11663

External Database ID

Nucleotide (282bp)

>JHU11663
ATGGAAGGTCACTATGTTCATGCTGGGAACATCATTGCAACACAGCGCCATTTCCGCTGGCACCCAGGTGCCCATGTGGG
TGTTGGGAAGAATAAATGTCTGTATGCCCTGGAAGAGGGGATAGTCCGCTACACTAAGGAGGTCTACGTGCCTCATCCCA
GAAACACGGAGGCTGTGGATCTGATCACCAGGCTGCCCAAGGGTGCTGTGCTCTACAAGACTTTTGTCCACGTGGTTCCT
GCCAAGCCTGAGGGCACCTTCAAACTGGTAGCTATGCTTTAG

Protein (93aa)

>JHU11663
MEGHYVHAGNIIATQRHFRWHPGAHVGVGKNKCLYALEEGIVRYTKEVYVPHPRNTEAVDLITRLPKGAVLYKTFVHVVP
AKPEGTFKLVAML