Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11661 BC009991.2_frag Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
22 16 9 JHU11661
22 16 10 JHU11661
HuProt v3.0
Block Row Column Clone
14 1 17 JHU11661
14 2 17 JHU11661
HuProt v3.1
Block Row Column Clone
14 1 17 JHU11661
14 2 17 JHU11661

Nucleotide (465bp)

>JHU11661
ATGCAGCTGTCAGGGAATGGCCTGGAGGAGCAGGCGGCCCAGCACCTTGATGAACTCCTGCTGGCCCACACAGACCTGAA
GTCCCTGGACCTGAGCTACAACCAGCTGAATGACCAAGCAGATCTGTGCATGGGACTGCAGGGCTTCCTCATCTTCCACA
GCTTTGGGGGCGGCACTGGCTCTGGGTTCGTGTCTCTGCTCATGAAGCGGCTCTCGGTGGACTACGGGAAGAAGTCCAAG
CTGGAGTTTGCCATTTGCCCAGCCCCCCAGGTCTCCATGGCCATGACGGAGCCCTACAACTCCATCCTGACCACCTACAC
GACCCTGGAACATTCTGACTGTGCCTTCATAGTCAACAGCAAAGCCACCTATGACATGTCAGCACAACCTGGACATCGAG
TGTCCCACGTACACCAACCTCAGTCGTCTGGGCAGATCGTGTCCTCCATCACGGCCTCCCTGTAG

Protein (154aa)

>JHU11661
MQLSGNGLEEQAAQHLDELLLAHTDLKSLDLSYNQLNDQADLCMGLQGFLIFHSFGGGTGSGFVSLLMKRLSVDYGKKSK
LEFAICPAPQVSMAMTEPYNSILTTYTTLEHSDCAFIVNSKATYDMSAQPGHRVSHVHQPQSSGQIVSSITASL