Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11659 LINC00858_frag Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
32 16 15 JHU11659
32 16 16 JHU11659
HuProt v3.0
Block Row Column Clone
13 5 14 JHU11659
13 6 14 JHU11659
HuProt v3.1
Block Row Column Clone
13 5 14 JHU11659
13 6 14 JHU11659

Nucleotide (339bp)

>JHU11659
ATGACGGACTTGGCCTCAGGGCCCCAAGCCTTCCCTGTTGCAGTCTTCATGACACTCCTCAGAAGCAGCAACTCCAGCCA
TGTCTGGAACCATTCCTTACCAGACAGGAGGATATCATGGCCTCAACTCATGATCTGTACCAAGCCAAACCTCTTTTGGG
GTACCCACCAAGCCTCAGGCCTCACCTTCTCTGCCCTGTTGTCCCTGCCCATCTGTCCTGGTTTTCTACTAGTTTCCACT
ACTGGACACTTGTCTGAGGCTGGGTCCCCACCTGGATCTTGTGGCCTCTTGCCCAGGGCTTGGAGGGAAGCTGCTCCCAC
ACTTGAAGATGACAGCTAG

Protein (112aa)

>JHU11659
MTDLASGPQAFPVAVFMTLLRSSNSSHVWNHSLPDRRISWPQLMICTKPNLFWGTHQASGLTFSALLSLPICPGFLLVST
TGHLSEAGSPPGSCGLLPRAWREAAPTLEDDS