Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11645 GLCE KIAA0836 Homo sapiens Yes Metabolism

HuProt v2.0
Block Row Column Clone
40 16 15 JHU11645
40 16 16 JHU11645
HuProt v3.0
Block Row Column Clone
13 5 22 JHU11645
13 6 22 JHU11645
HuProt v3.1
Block Row Column Clone
13 5 22 JHU11645
13 6 22 JHU11645

External Database ID

Nucleotide (1854bp)

>JHU11645
ATGCGTTGCTTGGCAGCTCGGGTCAACTATAAGACTTTGATTATTATCTGCGCACTCTTCACTTTGGTCACAGTACTTTT
GTGGAATAAGTGTTCCAGTGACAAAGCAATCCAGTTTCCACGGCGTTCGAGTAGTGGCTTCAGAGTGGATGGGTTTGAAA
AAAGAGCAGCAGCATCTGAGAGTAACAACTATATGAACCACGTGGCCAAACAACAGTCTGAGGAAGCATTCCCTCAGGAA
CAGCAGAAAGCACCCCCTGTTGTTGGGGGCTTCAATAGCAATGTGGGAAGTAAGGTGTTAGGGCTCAAATATGAAGAAAT
TGACTGTCTCATAAATGATGAACACACAATTAAAGGGAGACGAGAGGGGAACGAAGTCTTTCTTCCATTCACTTGGGTTG
AGAAATATTTTGATGTTTATGGAAAGGTGGTTCAGTATGATGGCTATGATCGGTTTGAATTCTCTCATAGCTATTCCAAA
GTCTATGCACAGAGAGCCCCCTATCACCCCGATGGTGTGTTTATGTCTTTTGAAGGCTACAATGTGGAAGTCCGAGACAG
AGTCAAGTGCATAAGTGGGGTTGAAGGTGTGCCATTATCTACACAATGGGGACCTCAAGGCTATTTCTATCCAATCCAGA
TTGCACAGTATGGATTAAGTCATTACAGCAAGAATCTAACTGAGAAACCTCCTCACATAGAGGTATATGAAACAGCAGAA
GACAGAGACAAAAACAAGCCTAATGACTGGACTGTGCCAAAGGGCTGCTTTATGGCGAATGTGGCTGATAAGTCTAGATT
CACCAATGTCAAACAGTTTATTGCACCAGAAACCAGTGAAGGTGTATCCTTGCAACTGGGAAACACAAAAGATTTTATTA
TTTCATTTGACCTCAAGTTCTTGACAAATGGAAGTGTGTCCGTGGTTCTAGAGACCACAGAAAAGAATCAGCTCTTCACT
ATACATTATGTCTCAAATGCTCAGCTAATTGCTTTTAAAGAAAGAGATATATACTATGGCATTGGGCCCAGAACTTCATG
GAGCACAGTTACCAGGGACCTGGTCACTGACCTCAGGAAAGGAGTGGGTCTTTCAAACACAAAAGCTGTCAAGCCAACCA
AAATAATGCCCAAGAAGGTGGTTAGGTTGATTGCAAAAGGTAAGGGATTCCTCGACAACATTACCATCTCTACCACAGCC
CACATGGCTGCATTTTTTGCTGCTAGTGATTGGCTAGTAAGGAACCAGGATGAGAAAGGTGGCTGGCCAATTATGGTGAC
CCGTAAGTTAGGGGAAGGGTTCAAGTCTTTAGAGCCAGGATGGTATTCTGCCATGGCCCAAGGGCAAGCCATTTCTACAT
TAGTCAGGGCCTATCTGTTAACAAAAGACCATATATTCCTCAATTCAGCTTTAAGGGCAACAGCCCCTTATAAGTTTCTA
TCTGAGCAGCATGGAGTTAAAGCTGTGTTTATGAATAAACATGACTGGTATGAAGAATATCCAACCACACCTAGCTCTTT
TGTTTTAAATGGCTTTATGTATTCTTTAATTGGGCTGTATGACTTAAAAGAAACTGCAGGGGAAAAACTCGGAAAAGAAG
CAAGGTCCTTGTATGAGCGTGGCATGGAATCTCTTAAAGCCATGCTGCCCTTGTATGACACTGGCTCAGGAACCATCTAT
GACCTCCGTCACTTCATGCTTGGCATCGCTCCTAACCTGGCTCGCTGGGACTATCATACCACCCACATCAATCAGTTGCA
GCTACTCAGTACCATTGATGAGTCCCCAGTCTTCAAAGAATTTGTCAAGAGGTGGAAAAGCTACCTTAAAGGCAGCAGGG
CAAAGCACAACTAG

Protein (617aa)

>JHU11645
MRCLAARVNYKTLIIICALFTLVTVLLWNKCSSDKAIQFPRRSSSGFRVDGFEKRAAASESNNYMNHVAKQQSEEAFPQE
QQKAPPVVGGFNSNVGSKVLGLKYEEIDCLINDEHTIKGRREGNEVFLPFTWVEKYFDVYGKVVQYDGYDRFEFSHSYSK
VYAQRAPYHPDGVFMSFEGYNVEVRDRVKCISGVEGVPLSTQWGPQGYFYPIQIAQYGLSHYSKNLTEKPPHIEVYETAE
DRDKNKPNDWTVPKGCFMANVADKSRFTNVKQFIAPETSEGVSLQLGNTKDFIISFDLKFLTNGSVSVVLETTEKNQLFT
IHYVSNAQLIAFKERDIYYGIGPRTSWSTVTRDLVTDLRKGVGLSNTKAVKPTKIMPKKVVRLIAKGKGFLDNITISTTA
HMAAFFAASDWLVRNQDEKGGWPIMVTRKLGEGFKSLEPGWYSAMAQGQAISTLVRAYLLTKDHIFLNSALRATAPYKFL
SEQHGVKAVFMNKHDWYEEYPTTPSSFVLNGFMYSLIGLYDLKETAGEKLGKEARSLYERGMESLKAMLPLYDTGSGTIY
DLRHFMLGIAPNLARWDYHTTHINQLQLLSTIDESPVFKEFVKRWKSYLKGSRAKHN