Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11643 MSTN GDF8 Homo sapiens Yes Kinases; Secreted Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
48 16 15 JHU11643
48 16 16 JHU11643
HuProt v3.0
Block Row Column Clone
13 5 32 JHU11643
13 6 32 JHU11643
HuProt v3.1
Block Row Column Clone
13 5 32 JHU11643
13 6 32 JHU11643

External Database ID

Nucleotide (1128bp)

>JHU11643
ATGCAAAAACTGCAACTCTGTGTTTATATTTACCTGTTTATGCTGATTGTTGCTGGTCCAGTGGATCTAAATGAGAACAG
TGAGCAAAAAGAAAATGTGGAAAAAGAGGGGCTGTGTAATGCATGTACTTGGAGACAAAACACTAAATCTTCAAGAATAG
AAGCCATTAAGATACAAATCCTCAGTAAACTTCGTCTGGAAACAGCTCCTAACATCAGCAAAGATGTTATAAGACAACTT
TTACCCAAAGCTCCTCCACTCCGGGAACTGATTGATCAGTATGATGTCCAGAGGGATGACAGCAGCGATGGCTCTTTGGA
AGATGACGATTATCACGCTACAACGGAAACAATCATTACCATGCCTACAGAGTCTGATTTTCTAATGCAAGTGGATGGAA
AACCCAAATGTTGCTTCTTTAAATTTAGCTCTAAAATACAATACAATAAAGTAGTAAAGGCCCAACTATGGATATATTTG
AGACCCGTCGAGACTCCTACAACAGTGTTTGTGCAAATCCTGAGACTCATCAAACCTATGAAAGACGGTACAAGGTATAC
TGGAATCCGATCTCTGAAACTTGACATGAACCCAGGCACTGGTATTTGGCAGAGCATTGATGTGAAGACAGTGTTGCAAA
ATTGGCTCAAACAACCTGAATCCAACTTAGGCATTGAAATAAAAGCTTTAGATGAGAATGGTCATGATCTTGCTGTAACC
TTCCCAGGACCAGGAGAAGATGGGCTGAATCCGTTTTTAGAGGTCAAGGTAACAGACACACCAAAAAGATCCAGAAGGGA
TTTTGGTCTTGACTGTGATGAGCACTCAACAGAATCACGATGCTGTCGTTACCCTCTAACTGTGGATTTTGAAGCTTTTG
GATGGGATTGGATTATCGCTCCTAAAAGATATAAGGCCAATTACTGCTCTGGAGAGTGTGAATTTGTATTTTTACAAAAA
TATCCTCATACTCATCTGGTACACCAAGCAAACCCCAGAGGTTCAGCAGGCCCTTGCTGTACTCCCACAAAGATGTCTCC
AATTAATATGCTATATTTTAATGGCAAAGAACAAATAATATATGGGAAAATTCCAGCGATGGTAGTAGACCGCTGTGGGT
GCTCATAG

Protein (375aa)

>JHU11643
MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQL
LPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYL
RPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVT
FPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQK
YPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS