Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11642 GAS2L1 GAR22 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
30 16 9 JHU11642
30 16 10 JHU11642
HuProt v3.0
Block Row Column Clone
14 1 27 JHU11642
14 2 27 JHU11642
HuProt v3.1
Block Row Column Clone
14 1 27 JHU11642
14 2 27 JHU11642

External Database ID

Nucleotide (1014bp)

>JHU11642
ATGGCAGACCCAGTGGCGGGCATCGCGGGCTCGGCGGCCAAGAGCGTGCGGCCATTTCGCTCCAGTGAGGCCTACGTGGA
GGCCATGAAGGAGGACCTGGCCGAGTGGCTCAATGCCTTGTACGGCCTGGGTCTCCCGGGTGGTGGCGATGGCTTCCTGA
CAGGGCTGGCCACGGGCACGACCCTGTGCCAACATGCCAACGCCGTGACCGAGGCTGCCCGTGCATTGGCAGCCGCCCGC
CCGGCCCGAGGTGTGGCCTTCCAGGCGCACAGTGTAGTGCCTGGCTCCTTCATGGCGCGCGACAACGTGGCCACCTTCAT
CGGCTGGTGCCGCGTGGAGCTGGGTGTGCCGGAGGTGCTCATGTTTGAGACTGAGGACCTGGTGCTGCGCAAGAACGAGA
AGAGCGTGGTGCTGTGCCTGCTGGAGGTGGCGCGGCGTGGGGCACGCCTGGGCCTGCTGGCCCCACGCCTCGTGCAGTTT
GAGCAGGAGATTGAGCGGGAGCTGCGTGCTGCACCCCCAGCCCCCAACGCCCCTGCCGCTGGGGAGGACACCACTGAAAC
CGCCCCCGCACCAGGGACTCCTGCCCGCGGCCCCCGCATGACACCCAGCGACCTGCGCAACCTCGACGAGCTGGTGAGGG
AGATTCTGGGCCGCTGCACCTGCCCTGACCAGTTTCCCATGATCAAGGTCTCAGAGGGGAAGTACCGTGTGGGGGACTCG
AGCCTGCTCATCTTTGTGCGGGTGCTGAGGAGCCACGTGATGGTGCGAGTGGGTGGTGGCTGGGACACGCTGGAGCATTA
CCTGGACAAGCACGACCCGTGCCGCTGCTCCTCCACTGCTCATCGCCCACCCCAGCCGAGGGTCTGCACCTTTTCTCCAC
AGAGGGTGTCGCCCACCACCAGTCCCCGCCCTGCTAGCCCAGTCCCTGGGAGTGAGCGCCGGGGCTCCCGGCCTGAGATG
ACTCCCGTTAGCTTACGAAGCACAAAGGAGGGGCCCGAGACCCCACCCAGGTAG

Protein (337aa)

>JHU11642
MADPVAGIAGSAAKSVRPFRSSEAYVEAMKEDLAEWLNALYGLGLPGGGDGFLTGLATGTTLCQHANAVTEAARALAAAR
PARGVAFQAHSVVPGSFMARDNVATFIGWCRVELGVPEVLMFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQF
EQEIERELRAAPPAPNAPAAGEDTTETAPAPGTPARGPRMTPSDLRNLDELVREILGRCTCPDQFPMIKVSEGKYRVGDS
SLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCRCSSTAHRPPQPRVCTFSPQRVSPTTSPRPASPVPGSERRGSRPEM
TPVSLRSTKEGPETPPR