Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11632 CT55 CXorf48 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
16 16 5 JHU11632
16 16 6 JHU11632
HuProt v3.0
Block Row Column Clone
15 1 14 JHU11632
15 2 14 JHU11632
HuProt v3.1
Block Row Column Clone
15 1 14 JHU11632
15 2 14 JHU11632

External Database ID

Nucleotide (729bp)

>JHU11632
ATGCTCAGGCTTCTGAGACTTGCTTTGGCCTTCTACGGGAGGACGGCCGACCCTGCAGAGCGACAGGGCCCACAGCAGCA
GGGCCTCCCACAAGGTGACACCCAGTTGACAACTGTGCAGGGAGTTGTCACAAGTTTCTGTGGTGATTATGGCATGATTG
ATGAGTCGATCTACTTCAGTAGTGATGTTGTGACTGGCAACGTGCCTCTAAAAGTTGGACAAAAAGTTAATGTGGTTGTG
GAAGAAGATAAACCACATTATGGATTGAGAGCAATCAAGGTGGATGTTGTGCCTCGCCATCTTTATGGTGCTGGACCCTC
AGACTCAGGAACCAGAGTTTTAATTGGATGTGTTACTTCTATAAATGAAGATAATATTTATATTAGTAACAGCATTTATT
TTTCCATAGCCATTGTTTCTGAAGATTTTGTGCCTTATAAGGGTGACTTGTTAGAAGTTGAATATTCCACTGAGCCAGGC
ATCTCAAACATCAAGGCAACTTCTGTGAAGCCCATCCGTTGTATTCATACGGAAGAGGTCTGCATTACTAGCGTACATGG
AAGAAATGGGGTGATAGATTATACTATTTTTTTCACCTTGGATTCTGTGAAACTTCCTGATGGATACGTACCTCAAGTAG
ATGATATCGTCAATGTGGTCATGGTGGAGAGCATTCAGTTCTGCTTTATTTGGAGAGCGATTTCTATCACCCCAGTGCAT
AAATCGTAG

Protein (242aa)

>JHU11632
MLRLLRLALAFYGRTADPAERQGPQQQGLPQGDTQLTTVQGVVTSFCGDYGMIDESIYFSSDVVTGNVPLKVGQKVNVVV
EEDKPHYGLRAIKVDVVPRHLYGAGPSDSGTRVLIGCVTSINEDNIYISNSIYFSIAIVSEDFVPYKGDLLEVEYSTEPG
ISNIKATSVKPIRCIHTEEVCITSVHGRNGVIDYTIFFTLDSVKLPDGYVPQVDDIVNVVMVESIQFCFIWRAISITPVH
KS