Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11630 CREM Homo sapiens Yes Kinases; Nuclear Proteins; Signal Transduction; Transcription Factors

HuProt v2.0
Block Row Column Clone
46 16 15 JHU11630
46 16 16 JHU11630
HuProt v3.0
Block Row Column Clone
13 5 27 JHU11630
13 6 27 JHU11630
HuProt v3.1
Block Row Column Clone
13 5 27 JHU11630
13 6 27 JHU11630

External Database ID

Nucleotide (666bp)

>JHU11630
ATGACCATGGAAACAGTTGAATCCCAGCATGATGGAAGTATAACAGCTTCTTTGACAGAGAGCAAGTCTGCTCATGTGCA
GACTCAGACTGGCCAAAATTCAATCCCTGCTTTAGCTCAGGTAGCAGCAATTGCAGAGACAGATGAATCTGCAGAATCAG
AAGGTGTAATTGATTCTCATAAACGTAGAGAAATCCTTTCACGAAGACCCTCTTATAGGAAAATACTGAATGAACTGTCC
TCTGATGTGCCTGGTGTTCCCAAGATTGAAGAAGAGAGATCAGAGGAAGAAGGAACACCACCTAGTATTGCTACCATGGC
AGTACCAACTAGCATATATCAGACTAGCACGGGGCAATACACTGCCACTGGTGACATGCCAACTTACCAGATCCGAGCTC
CTACTGCTGCTTTGCCACAGGGAGTGGTGATGGCTGCATCGCCCGGAAGTTTGCACAGTCCCCAGCAGCTGGCAGAAGAA
GCAACACGCAAACGAGAGCTGAGGCTAATGAAAAACAGGGAAGCTGCCAAAGAATGTCGACGTCGAAAGAAAGAATATGT
AAAATGTCTGGAGAGCCGAGTTGCAGTGCTGGAAGTCCAGAACAAGAAGCTTATAGAGGAACTTGAAACCTTGAAAGACA
TTTGTTCTCCCAAAACAGATTACTAG

Protein (221aa)

>JHU11630
MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELS
SDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYTATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEE
ATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY