Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11614 DLEU1 LEU1;XTP6 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
44 16 15 JHU11614
44 16 16 JHU11614
HuProt v3.0
Block Row Column Clone
13 5 26 JHU11614
13 6 26 JHU11614
HuProt v3.1
Block Row Column Clone
13 5 26 JHU11614
13 6 26 JHU11614

External Database ID

Nucleotide (219bp)

>JHU11614
ATGAGACCTTGTATATGGATACACGTGCATTTAAAACCGCCCTGCCGGCTTGTAGAGCTTTTGCCGTTCTCCAGCGCTTT
ACAGGGGTTATCGCACTTAAGCCTCGGAACAACTTTACCAGTGATTCTACCAGAAAGGAATGAAGAACAGAACCTTCAGG
AATTGAGTCACAATGCAGACAAATATCAAATGGGAGATTGTTGCAAGGAAGAGATTTAG

Protein (72aa)

>JHU11614
MRPCIWIHVHLKPPCRLVELLPFSSALQGLSHLSLGTTLPVILPERNEEQNLQELSHNADKYQMGDCCKEEI