Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11610 ZPBP2 ZPBPL Homo sapiens Yes Secreted Proteins

HuProt v2.0
Block Row Column Clone
28 16 1 JHU11610
28 16 2 JHU11610
HuProt v3.0
Block Row Column Clone
16 1 26 JHU11610
16 2 26 JHU11610
HuProt v3.1
Block Row Column Clone
16 1 26 JHU11610
16 2 26 JHU11610

External Database ID

Nucleotide (948bp)

>JHU11610
ATGCGAACGTGCGTCCTACTCTCCGCGGTGCTCTGGTGCCTCACAGGAGACAAAATATATGTAGAGTTACATCAAAATAG
TCCAGTCCTTATCTGTATGGATTTTAAGCTTTCTAAAAAAGAAATAGTGGACCCCACCTACTTATGGATTGGGCCTAATG
AAAAGACGTTAACAGGAAATAATAGAATAAATATAACTGAAACTGGACAGCTGATGGTGAAAGATTTTTTGGAGCCTTTG
TCTGGACTTTACACATGTACTCTTTCTTATAAGACTGTTAAAGCAGAAACTCAAGAAGAAAAAACAGTCAAAAAGAGATA
TGACTTTATGGTCTTTGCCTATCGGGAACCTGATTATTCATATCAGATGGCTGTACGTTTTACCACAAGGTCTTGTATAG
GGAGATACAATGATGTATTCTTTAGAGTGCTGAAGAAAATCTTGGATAGTCTAATTTCTGATTTGTCATGCCATGTCATA
GAGCCATCATATAAATGCCATTCTGTTGAAATTCCAGAACATGGCCTCATACATGAGCTATTTATAGCATTTCAAGTTAA
TCCTTTTGCGCCGGGGTGGAAAGGTGCTTGCAATGGATCTGTTGACTGTGAAGATACCACTAATCATAATATCCTCCAGG
CAAGAGATCGAATAGAAGACTTTTTTCGGAGCCAAGCATATATTTTCTACCATAACTTTAATAAAACTCTACCAGCAATG
CATTTTGTGGACCACAGTTTGCAAGTAGTACGTCTGGATAGCTGTCGACCAGGCTTTGGAAAAAATGAACGTCTACACAG
TAATTGCGCTAGCTGTTGTGTGGTTTGTAGTCCTGCGACTTTTAGTCCTGATGTTAATGTAACTTGTCAGACCTGCGTTT
CCGTCCTTACCTATGGAGCTAAATCTTGCCCACAAACTTCAAACAAAAATCAGCAATATGAAGATTAG

Protein (315aa)

>JHU11610
MRTCVLLSAVLWCLTGDKIYVELHQNSPVLICMDFKLSKKEIVDPTYLWIGPNEKTLTGNNRINITETGQLMVKDFLEPL
SGLYTCTLSYKTVKAETQEEKTVKKRYDFMVFAYREPDYSYQMAVRFTTRSCIGRYNDVFFRVLKKILDSLISDLSCHVI
EPSYKCHSVEIPEHGLIHELFIAFQVNPFAPGWKGACNGSVDCEDTTNHNILQARDRIEDFFRSQAYIFYHNFNKTLPAM
HFVDHSLQVVRLDSCRPGFGKNERLHSNCASCCVVCSPATFSPDVNVTCQTCVSVLTYGAKSCPQTSNKNQQYED