Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11605 USF1 BHLHB11;USF Homo sapiens Yes Kinases; Nuclear Proteins; Transcription Factors

HuProt v2.0
Block Row Column Clone
34 16 15 JHU11605
34 16 16 JHU11605
HuProt v3.0
Block Row Column Clone
13 5 3 JHU11605
13 6 3 JHU11605
HuProt v3.1
Block Row Column Clone
13 5 3 JHU11605
13 6 3 JHU11605

External Database ID

Nucleotide (756bp)

>JHU11605
ATGTACAGGGTGATCCAGGTGTCTGAGGGGCAGCTGGATGGCCAAACTGAGGGAACTGGCGCCATCAGTGGCTACCCTGC
CACTCAATCCATGACCCAGGCGGTGATCCAGGGTGCTTTCACCAGTGATGATGCAGTTGACACGGAGGGGACAGCTGCTG
AGACGCACTATACTTACTTCCCCAGCACGGCAGTGGGAGATGGGGCAGGGGGTACCACATCGGGGAGTACAGCTGCTGTT
GTTACTACCCAGGGCTCAGAGGCACTGCTGGGGCAGGCGACCCCTCCTGGCACTGGTCAATTCTTTGTGATGATGTCACC
ACAAGAAGTACTGCAGGGAGGAAGCCAGCGCTCAATTGCCCCTAGGACTCACCCTTATTCCCCGAAGTCAGAAGCTCCCC
GGACGACTCGGGATGAGAAACGCAGGGCTCAGCATAATGAAGTGGAGCGTCGCCGCCGAGACAAGATCAACAACTGGATC
GTGCAGCTCTCCAAGATAATCCCAGACTGCTCTATGGAGAGCACCAAGTCTGGCCAGAGTAAAGGTGGGATTCTATCCAA
AGCTTGTGATTATATCCAGGAGCTTCGGCAGAGTAACCACCGCTTGTCTGAAGAACTGCAGGGACTTGACCAACTGCAGC
TGGACAATGACGTGCTTCGACAACAGGTGGAAGATCTTAAAAACAAGAATCTGCTGCTTCGAGCTCAGTTGCGGCACCAC
GGATTAGAGGTCGTCATCAAGAATGACAGCAACTAG

Protein (251aa)

>JHU11605
MYRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGTAAETHYTYFPSTAVGDGAGGTTSGSTAAV
VTTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAPRTHPYSPKSEAPRTTRDEKRRAQHNEVERRRRDKINNWI
VQLSKIIPDCSMESTKSGQSKGGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLRHH
GLEVVIKNDSN