Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11593 TCF7 TCF1 Homo sapiens Yes Nuclear Proteins; Signal Transduction; Transcription Factors

HuProt v2.0
Block Row Column Clone
28 16 13 JHU11593
28 16 14 JHU11593
HuProt v3.0
Block Row Column Clone
13 1 26 JHU11593
13 2 26 JHU11593
HuProt v3.1
Block Row Column Clone
13 1 26 JHU11593
13 2 26 JHU11593

External Database ID

Nucleotide (810bp)

>JHU11593
ATGTACAAAGAGACCGTCTACTCCGCCTTCAATCTGCTCATGCATTACCCACCCCCCTCGGGAGCAGGGCAGCACCCCCA
GCCGCAGCCCCCGCTGCACAAGGCCAATCAGCCCCCCCACGGTGTCCCCCAACTCTCTCTCTACGAACATTTCAACAGCC
CACATCCCACCCCTGCACCTGCGGACATCAGCCAGAAGCAAGTTCACAGGCCTCTGCAGACCCCTGACCTCTCTGGCTTC
TACTCCCTGACCTCAGGCAGCATGGGGCAGCTCCCCCACACTGTGAGCTGGTTCACCCACCCATCCTTGATGCTAGGTTC
TGGTGTACCTGGTCACCCAGCAGCCATCCCCCACCCGGCCATTGTGCCCCCCTCAGGGAAGCAGGAGCTGCAGCCCTTCG
ACCGCAACCTGAAGACACAAGCAGAGTCCAAGGCAGAGAAGGAGGCCAAGAAGCCAACCATCAAGAAGCCCCTCAATGCC
TTCATGCTGTACATGAAGGAGATGAGAGCCAAGGTCATTGCAGAGTGCACACTTAAGGAGAGCGCTGCCATCAACCAGAT
CCTGGGCCGCAGGTGGCACGCGCTGTCGCGAGAAGAGCAGGCCAAGTACTATGAGCTGGCCCGCAAGGAGAGGCAGCTGC
ACATGCAGCTATACCCAGGCTGGTCAGCGCGGGACAACTACGGGAAGAAGAAGAGGCGGTCGAGGGAAAAGCACCAAGAA
TCCACCACAGGAGGAAAAAGAAATGCATTCGGTACTTACCCGGAGAAGGCCGCTGCCCCAGCCCCGTTCCTTCCGATGAC
AGTGCTCTAG

Protein (269aa)

>JHU11593
MYKETVYSAFNLLMHYPPPSGAGQHPQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTPDLSGF
YSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNA
FMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQE
STTGGKRNAFGTYPEKAAAPAPFLPMTVL