Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00116 CHP1 CHP Homo sapiens Yes Cell Death; Kinases; Membrane Proteins; Nuclear Proteins; Signal Transduction; Transcription Factors

HuProt v2.0
Block Row Column Clone
24 1 7 JHU00116
24 1 8 JHU00116
HuProt v3.0
Block Row Column Clone
3 5 8 JHU00116
3 6 8 JHU00116
HuProt v3.1
Block Row Column Clone
3 5 8 JHU00116
3 6 8 JHU00116

External Database ID

Nucleotide (588bp)

>JHU00116
ATGGGTTCTCGGGCCTCCACGTTACTGCGGGACGAAGAGCTCGAGGAGATCAAGAAGGAGACCGGCTTTTCCCACAGTCA
AATCACTCGCCTCTACAGCCGGTTCACCAGCCTGGACAAAGGAGAGAATGGGACTCTCAGCCGGGAAGATTTCCAGAGGA
TTCCAGAACTTGCCATCAACCCACTGGGGGACCGGATCATCAATGCCTTCTTTCCAGAGGGAGAGGACCAGGTAAACTTC
CGTGGATTCATGCGAACTTTGGCTCATTTCCGCCCCATTGAGGATAATGAAAAGAGCAAAGATGTGAATGGACCCGAACC
ACTCAACAGCCGAAGCAACAAACTGCACTTTGCTTTTCGACTATATGATTTGGATAAAGATGAAAAGATCTCCCGTGATG
AGCTGTTACAGGTGCTACGCATGATGGTCGGAGTAAATATCTCAGATGAGCAGCTGGGCAGCATCGCAGACAGGACCATT
CAGGAGGCTGATCAGGATGGGGACAGTGCCATATCTTTCACAGAATTTGTTAAGGTTTTGGAGAAGGTGGATGTAGAACA
GAAAATGAGCATCCGATTTCTTCACTAG

Protein (195aa)

>JHU00116
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNF
RGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTI
QEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH