Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11586 SLC35E1_frag Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
4 16 1 JHU11586
4 16 2 JHU11586
HuProt v3.0
Block Row Column Clone
16 1 2 JHU11586
16 2 2 JHU11586
HuProt v3.1
Block Row Column Clone
16 1 2 JHU11586
16 2 2 JHU11586

External Database ID
  • Reviewed UniProt: Q96K37-2 (S35E1_HUMAN)

Nucleotide (801bp)

>JHU11586
ATGCCCATCTGGGTGGTCCTCCTGTCCCGGATCATTATGAAGGAGAAGCAGAGCACCAAGGTATACTTGTCACTCATCCC
CATCATCAGCGGTGTCCTGCTGGCCACCGTCACCGAGTTGTCTTTTGACATGTGGGGACTCGTCAGCGCCCTCGCCGCCA
CGCTGTGCTTCTCGCTTCAGAACATTTTCTCCAAAAAGGTCTTGCGAGATTCACGGATCCACCATCTCCGGCTGCTCAAC
ATCCTGGGCTGCCACGCCGTCTTCTTTATGATCCCCACCTGGGTTCTGGTGGACCTCTCGGCTTTCCTGGTCAGCAGCGA
CTTGACCTACGTCTACCAGTGGCCCTGGACGCTCCTGCTCCTGGCTGTCAGCGGCTTCTGTAACTTTGCCCAGAATGTTA
TCGCCTTCAGCATCCTCAACCTCGTTAGCCCCCTGAGCTACTCGGTCGCCAATGCCACCAAAAGAATCATGGTCATCACG
GTGTCCCTGATCATGCTGCGCAACCCAGTCACCAGCACCAACGTCCTGGGCATGATGACCGCCATCCTGGGGGTCTTCCT
CTATAACAAGACCAAGTACGATGCAAACCAGCAAGCCAGGAAGCACCTCCTCCCCGTCACCACAGCAGACCTGAGCAGCA
AGGAGCGTCACCGGAGCCCACTGGAGAAGCCCCACAACGGCCTCCTCTTCCCCCAGCACGGGGACTATCAGTACGGCCGC
AACAACATCTTAACAGACCACTTCCAATACAGCCGGCAGAGCTACCCAAACTCGTACAGTTTGAACCGCTATGATGTGTA
G

Protein (266aa)

>JHU11586
MPIWVVLLSRIIMKEKQSTKVYLSLIPIISGVLLATVTELSFDMWGLVSALAATLCFSLQNIFSKKVLRDSRIHHLRLLN
ILGCHAVFFMIPTWVLVDLSAFLVSSDLTYVYQWPWTLLLLAVSGFCNFAQNVIAFSILNLVSPLSYSVANATKRIMVIT
VSLIMLRNPVTSTNVLGMMTAILGVFLYNKTKYDANQQARKHLLPVTTADLSSKERHRSPLEKPHNGLLFPQHGDYQYGR
NNILTDHFQYSRQSYPNSYSLNRYDV