Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11569 NUSAP1_frag ANKT Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
20 16 13 JHU11569
20 16 14 JHU11569
HuProt v3.0
Block Row Column Clone
13 1 20 JHU11569
13 2 20 JHU11569
HuProt v3.1
Block Row Column Clone
13 1 20 JHU11569
13 2 20 JHU11569

Nucleotide (681bp)

>JHU11569
ATGAATGAACTGAAGCAGCAGCCCATCAATAAGGGAGGGGTCAGGACTCCAGTACCTCCAAGAGGAAGACTCTCTGTGGC
TTCTACTCCCATCAGCCAACGACGCTCGCAAGGCCGGTCTTGTGGCCCTGCAAGTCAGAGTACCTTGGGTCTGAAGGGGT
CACTCAAGCGCTCTGCTATCTCTGCAGCTAAAACGGGTGTCAGGTTTTCAGCTGCTACTAAAGATAATGAGCATAAGCGT
TCACTGACCAAGACTCCAGCCAGAAAGTCTGCACATGTGACCGTGTCTGGGGGCACCCCAAAAGGCGAGGCTGTGCTTGG
GACACACAAATTAAAGACCATCACGGGGAATTCTGCTGCTGTTATTACCCCATTCAAGTTGACAACTGAGGCAACGCAGA
CTCCAGTCTCCAATAAGAAACCAGTGTTTGATCTTAAAGCAAGTTTGTCTCGTCCCCTCAACTATGAACCACACAAAGGA
AAGCTAAAACCATGGGGGCAATCTAAAGAAAATAATTATCTAAATCAACATGTCAACAGAATTAACTTCTACAAGAAAAC
TTACAAACAACCCCATCTCCAGACAAAGGAAGAGCAACGGAAGAAACGCGAGCAAGAACGAAAGGAGAAGAAAGCAAAGG
TTTTGGGAATGCGAAGGGGCCTCATTTTGGCTGAAGATTAG

Protein (226aa)

>JHU11569
MNELKQQPINKGGVRTPVPPRGRLSVASTPISQRRSQGRSCGPASQSTLGLKGSLKRSAISAAKTGVRFSAATKDNEHKR
SLTKTPARKSAHVTVSGGTPKGEAVLGTHKLKTITGNSAAVITPFKLTTEATQTPVSNKKPVFDLKASLSRPLNYEPHKG
KLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQTKEEQRKKREQERKEKKAKVLGMRRGLILAED