Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11565 MSL3 MSL3L1 Homo sapiens Yes Nuclear Proteins

HuProt v2.0
Block Row Column Clone
18 16 15 JHU11565
18 16 16 JHU11565
HuProt v3.0
Block Row Column Clone
13 5 5 JHU11565
13 6 5 JHU11565
HuProt v3.1
Block Row Column Clone
13 5 5 JHU11565
13 6 5 JHU11565

External Database ID

Nucleotide (1068bp)

>JHU11565
ATGGAAGAAAGAACAATAACTATAGAAATCCCTGAAGTTCTGAAGAAGCAGCTGGAGGATGATTGTTACTACATTAACAG
GAGGAAACGGTTAGTGAAACTTCCATGCCAGACCAACATCATAACGATTTTGGAATCCTATGTGAAGCATTTTGCTATCA
ATGCAGCCTTTTCAGCCAATGAGAGGCCTCGTCACCATCACGTTATGCCACATGCCAACATGAACGTGCATTATATCCCA
GCAGAAAAGAATGTTGACCTTTGTAAGGAGATGGTGGATGGATTAAGAATAACCTTTGATTACACTCTCCCGTTGGTTTT
ACTCTATCCATATGAACAAGCTCAGTATAAAAAGGTGACTTCGTCTAAATTTTTTCTTCCAATTAAGGAAAGTGCCACAA
GCACTAACAGGAGCCAGGAGGAACTCTCTCCCAGTCCGCCTTTGTTGAATCCATCCACGCCACAGTCCACAGAGAGTCAG
CCGACCACCGGTGAACCAGCCACCCCCAAAAGGCGCAAAGCTGAGCCAGAAGCATTGCAGTCTCTGAGGCGGTCCACGCG
CCACAGTGCCAACTGTGACAGGCTTTCTGAGAGCAGCGCTTCACCTCAGCCCAAGCGCCGGCAGCAGGACACATCCGCCA
GCATGCCCAAGCTCTTCCTGCACCTGGAAAAGAAGACACCTGTGCATAGCAGATCATCTTCACCTATTCCTCTGACTCCT
AGCAAGGAAGGGAGTGCTGTGTTTGCTGGCTTTGAAGGGAGAAGAACTAATGAAATAAACGAGGTCCTCTCCTGGAAGCT
TGTGCCTGACAATTACCCCCCAGGTGACCAGCCGCCTCCACCCTCTTACATTTATGGGGCACAACATTTGCTGCGATTGT
TTGTGAAACTTCCAGAAATCCTTGGAAAGATGTCCTTTTCTGAGAAGAATCTGAAGGCTTTATTGAAGCACTTTGATCTC
TTTTTGAGGTTTTTAGCAGAATACCACGATGACTTCTTCCCAGAGTCGGCTTATGTCGCTGCCTGTGAGGCACATTACAG
CACCAAGAACCCCCGGGCAATTTATTAG

Protein (355aa)

>JHU11565
MEERTITIEIPEVLKKQLEDDCYYINRRKRLVKLPCQTNIITILESYVKHFAINAAFSANERPRHHHVMPHANMNVHYIP
AEKNVDLCKEMVDGLRITFDYTLPLVLLYPYEQAQYKKVTSSKFFLPIKESATSTNRSQEELSPSPPLLNPSTPQSTESQ
PTTGEPATPKRRKAEPEALQSLRRSTRHSANCDRLSESSASPQPKRRQQDTSASMPKLFLHLEKKTPVHSRSSSPIPLTP
SKEGSAVFAGFEGRRTNEINEVLSWKLVPDNYPPGDQPPPPSYIYGAQHLLRLFVKLPEILGKMSFSEKNLKALLKHFDL
FLRFLAEYHDDFFPESAYVAACEAHYSTKNPRAIY