Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11556 METTL13 KIAA0859 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
26 16 15 JHU11556
26 16 16 JHU11556
HuProt v3.0
Block Row Column Clone
13 5 15 JHU11556
13 6 15 JHU11556
HuProt v3.1
Block Row Column Clone
13 5 15 JHU11556
13 6 15 JHU11556

External Database ID

Nucleotide (1842bp)

>JHU11556
ATGAAGGAATGTAATGCCACCCGACGGCCCCAGATGAGCTTCTTGAAGATGGACATGACGCAGATGGAGTTTCCTGATGC
CTCGTTCCAGGTGGTGTTGGACAAGGGCACCCTGGATGCTGTCCTGACAGATGAGGAAGAGAAGACCTTACAACAGGTGG
ACAGGATGCTGGCTGAGGTTGGCCGTGTCCTGCAGGTGGGCGGTCGCTATCTCTGCATCTCCCTGGCTCAGGCTCACATC
CTGAAGAAAGCAGTGGGCCACTTCTCCCGGGAGGGGTGGATGGTGAGGGTGCACCAAGTGGCCAACAGCCAGGACCAGGT
GTTGGAAGCAGAGCCTCAGTTCTCCTTGCCTGTCTTTGCCTTCATCATGACCAAGTTCAGGCCAGTCCCTGGCTCTGCCC
TTCAGATCTTTGAGCTGTGTGCTCAGGAGCAGCGCAAGCCTGTGCGGCTGGAGAGTGCCGAGCGGCTGGCCGAGGCGGTG
CAGGAGCGACAGCAGTATGCCTGGCTGTGCAGCCAGCTGCGCCGCAAGGCCAGGCTGGGGAGTGTGTCTCTGGACTTGTG
CGATGGGGACACGGGGGAGCCACGCTACACCCTCCACGTGGTGGACAGCCCCACTGTGAAACCATCGCGGGACAATCATT
TTGCGATTTTCATCATCCCTCAGGGCCGGGAGACCGAGTGGCTCTTTGGCATGGATGAGGGCCGGAAACAGCTGGCGGCC
AGTGCTGGCTTCAGGAGGTTGATTACAGTGGCCCTTCACCGAGGTCAGCAGTATGAAAGCATGGACCACATCCAAGCTGA
GCTGTCGGCTAGAGTCATGGAGCTGGCCCCAGCTGGGATGCCCACCCAGCAGCAGGTCCCCTTTCTGTCTGTGGGTGGGG
ACATTGGGGTCCGGACCGTTCAGCACCAAGACTGCAGCCCCTTGAGCGGTGACTATGTCATTGAGGATGTGCAAGGGGAT
GACAAGCGATACTTCCGTCGACTGATCTTCCTCAGCAACAGGAATGTGGTGCAGTCCGAAGCCAGGTTGCTGAAGGATGT
GTCTCACAAAGCCCAGAAGAAGCGGAAAAAGGACAGGAAGAAGCAGCGGCCTGCTGATGCGGAGGACCTCCCTGCAGCCC
CGGGGCAGTCCATTGATAAGAGTTACCTGTGTTGTGAACACCACAAAGCCATGATCGCTGGCCTTGCCCTGCTGAGAAAC
CCAGAGCTACTCCTAGAGATCCCACTGGCATTGTTGGTGGTAGGCCTGGGCGGGGGCAGCCTCCCCCTCTTTGTCCACGA
TCATTTTCCAAAGTCCTGCATTGATGCTGTGGAGATCGATCCCTCCATGTTGGAAGTGGCCACCCAGTGGTTTGGCTTCT
CCCAGAGTGACCGAATGAAGGTCCACATTGCAGATGGCCTGGACTATATCGCCAGCTTGGCAGGAGGAGGAGAAGCACGG
CCTTGCTACGATGTCATAATGTTTGATGTTGACAGTAAGGACCCAACACTGGGAATGAGTTGTCCGCCCCCAGCATTTGT
GGAGCAATCTTTTCTACAGAAGGTTAAAAGCATCTTGACTCCTGAAGGTGTTTTTATTCTCAACCTTGTGTGCCGAGACT
TGGGGCTAAAAGACTCAGTGCTGGCTGGGCTCAAGGCAGTGTTCCCCCTCCTATATGTCCGGCGAATTGAGGGTGAAGTG
AATGAGATCCTGTTCTGTCAGCTGCACCCTGAGCAAAAACTTGCCACACCAGAGCTCCTAGAAACAGCCCAGGCTTTGGA
GCGGACCCTGAGGAAGCCTGGGAGGGGTTGGGATGACACGTATGTCTTGTCAGATATGCTCAAGACGGTGAAAATTGTGT
AG

Protein (613aa)

>JHU11556
MKECNATRRPQMSFLKMDMTQMEFPDASFQVVLDKGTLDAVLTDEEEKTLQQVDRMLAEVGRVLQVGGRYLCISLAQAHI
LKKAVGHFSREGWMVRVHQVANSQDQVLEAEPQFSLPVFAFIMTKFRPVPGSALQIFELCAQEQRKPVRLESAERLAEAV
QERQQYAWLCSQLRRKARLGSVSLDLCDGDTGEPRYTLHVVDSPTVKPSRDNHFAIFIIPQGRETEWLFGMDEGRKQLAA
SAGFRRLITVALHRGQQYESMDHIQAELSARVMELAPAGMPTQQQVPFLSVGGDIGVRTVQHQDCSPLSGDYVIEDVQGD
DKRYFRRLIFLSNRNVVQSEARLLKDVSHKAQKKRKKDRKKQRPADAEDLPAAPGQSIDKSYLCCEHHKAMIAGLALLRN
PELLLEIPLALLVVGLGGGSLPLFVHDHFPKSCIDAVEIDPSMLEVATQWFGFSQSDRMKVHIADGLDYIASLAGGGEAR
PCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKSILTPEGVFILNLVCRDLGLKDSVLAGLKAVFPLLYVRRIEGEV
NEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTVKIV