Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11549 GRINA LFG1;NMDARA1;TMBIM3 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
20 16 5 JHU11549
20 16 6 JHU11549
HuProt v3.0
Block Row Column Clone
15 1 20 JHU11549
15 2 20 JHU11549
HuProt v3.1
Block Row Column Clone
15 1 20 JHU11549
15 2 20 JHU11549

External Database ID

Nucleotide (1116bp)

>JHU11549
ATGTCCCATGAAAAGAGTTTTTTGGTGTCTGGGGACAACTATCCTCCCCCCAACCCTGGATATCCGGGGGGGCCCCAGCC
ACCCATGCCCCCCTATGCTCAGCCTCCCTACCCTGGGGCCCCTTATCCACAGCCCCCTTTCCAGCCCTCCCCCTACGGTC
AGCCAGGGTACCCCCATGGCCCCAGCCCCTACCCCCAAGGGGGCTACCCACAGGGTCCCTACCCCCAAGGGGGCTACCCA
CAGGGCCCCTACCCACAAGAGGGCTACCCACAGGGCCCCTACCCCCAAGGGGGCTACCCCCAGGGGCCATATCCCCAGAG
CCCCTTCCCCCCCAACCCCTATGGACAGCCACAGGTCTTCCCAGGACAAGACCCTGACTCACCCCAGCATGGAAACTACC
AGGAGGAGGGTCCCCCATCCTACTATGACAACCAGGACTTCCCTGCCACCAACTGGGATGACAAGAGCATCCGACAGGCC
TTCATCCGCAAGGTGTTCCTAGTGCTGACCTTGCAGCTGTCGGTGACCCTGTCCACGGTGTCTGTGTTCACTTTTGTTGC
GGAGGTGAAGGGCTTTGTCCGGGAGAATGTCTGGACCTACTATGTCTCCTATGCTGTCTTCTTCATCTCTCTCATCGTCC
TCAGCTGTTGTGGGGACTTCCGGCGAAAGCACCCCTGGAACCTTGTTGCACTGTCGGTCCTGACCGCCAGCCTGTCGTAC
ATGGTGGGGATGATCGCCAGCTTCTACAACACCGAGGCAGTCATCATGGCCGTGGGCATCACCACAGCCGTCTGCTTCAC
CGTCGTCATCTTCTCCATGCAGACCCGCTACGACTTCACCTCATGCATGGGCGTGCTCCTGGTGAGCATGGTGGTGCTCT
TCATCTTCGCCATTCTCTGCATCTTCATCCGGAACCGCATCCTGGAGATCGTGTACGCCTCACTGGGCGCTCTGCTCTTC
ACCTGCTTCCTCGCAGTGGACACCCAGCTGCTGCTGGGGAACAAGCAGCTGTCCCTGAGCCCAGAAGAGTATGTGTTTGC
TGCGCTGAACCTGTACACAGACATCATCAACATCTTCCTGTACATCCTCACCATCATTGGCCGCGCCAAGGAGTAG

Protein (371aa)

>JHU11549
MSHEKSFLVSGDNYPPPNPGYPGGPQPPMPPYAQPPYPGAPYPQPPFQPSPYGQPGYPHGPSPYPQGGYPQGPYPQGGYP
QGPYPQEGYPQGPYPQGGYPQGPYPQSPFPPNPYGQPQVFPGQDPDSPQHGNYQEEGPPSYYDNQDFPATNWDDKSIRQA
FIRKVFLVLTLQLSVTLSTVSVFTFVAEVKGFVRENVWTYYVSYAVFFISLIVLSCCGDFRRKHPWNLVALSVLTASLSY
MVGMIASFYNTEAVIMAVGITTAVCFTVVIFSMQTRYDFTSCMGVLLVSMVVLFIFAILCIFIRNRILEIVYASLGALLF
TCFLAVDTQLLLGNKQLSLSPEEYVFAALNLYTDIINIFLYILTIIGRAKE