Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11547 GDPD5 GDE2 Homo sapiens Yes Secreted Proteins

HuProt v2.0
Block Row Column Clone
42 16 15 JHU11547
42 16 16 JHU11547
HuProt v3.0
Block Row Column Clone
13 5 23 JHU11547
13 6 23 JHU11547
HuProt v3.1
Block Row Column Clone
13 5 23 JHU11547
13 6 23 JHU11547

External Database ID

Nucleotide (1818bp)

>JHU11547
ATGGTGAGACACCAGCCCCTGCAGTACTACGAGCCACAGCTGTGCCTCTCCTGCCTCACGGGCATCTACGGCTGCCGTTG
GAAGCGCTACCAGCGCTCCCATGATGATACCACACCGTGGGAGCGCCTCTGGTTCCTGCTCCTCACCTTCACCTTTGGCC
TCACGCTCACCTGGCTTTACTTCTGGTGGGAAGTCCACAATGACTATGATGAATTCAACTGGTACCTCTACAACCGCATG
GGCTACTGGAGCGACTGGCCCGTACCCATCCTTGTGACCACAGCTGCTGCCTTCGCATACATCGCTGGCCTCCTGGTCCT
GGCACTATGTCACATTGCCGTGGGGCAGCAGATGAACCTGCACTGGCTGCACAAGATCGGGCTGGTGGTCATCCTGGCTT
CCACGGTGGTGGCCATGTCGGCCGTGGCCCAGCTGTGGGAGGACGAGTGGGAGGTGCTGCTGATCTCCCTGCAGGGCACA
GCGCCATTCCTGCATGTGGGGGCTGTGGCAGCAGTCACCATGCTCTCCTGGATCGTGGCAGGACAGTTCGCCCGTGCAGA
GCGGACCTCCTCCCAGGTGACCATTCTCTGTACCTTCTTCACCGTGGTGTTTGCCCTCTACCTGGCCCCTCTCACCATCT
CCTCTCCCTGCATCATGGAGAAGAAAGACCTCGGCCCCAAGCCTGCTCTCATTGGCCACCGCGGGGCCCCCATGCTGGCT
CCAGAGCACACGCTCATGTCCTTCCGGAAGGCCCTCGAGCAGAAGCTGTACGGGCTCCAGGCTGACATTACCATCAGCCT
GGACGGCGTGCCCTTCCTCATGCATGACACCACCCTGCGGCGCACCACCAACGTGGAGGAGGAGTTCCCGGAGCTGGCCC
GCAGGCCTGCCTCCATGCTTAACTGGACCACCCTGCAGAGACTCAACGCTGGCCAGTGGTTCCTGAAGACTGACCCCTTC
TGGACAGCCAGCTCCCTGTCACCCTCCGACCACAGAGAGGCCCAGAACCAGTCCATCTGCAGCCTGGCAGAGCTCCTGGA
GCTGGCCAAGGGCAATGCCACACTGCTGCTCAACCTGCGTGACCCGCCCCGGGAGCACCCCTACCGCAGCAGTTTTATCA
ACGTGACTCTGGAGGCCGTGCTGCACTCCGGCTTCCCCCAGCACCAGGTCATGTGGCTGCCTAGCAGGCAGAGGCCCCTG
GTGCGGAAGGTGGCTCCCGGCTTCCAACAGACATCAGGCTCCAAGGAGGCAGTCGCCAGCCTGCGGAGAGGCCACATCCA
GCGGCTGAACCTGCGCTACACTCAGGTGTCCCGCCAGGAGCTCAGGGACTACGCGTCCTGGAACCTGAGTGTGAACCTCT
ACACAGTCAACGCACCGTGGCTCTTCTCCCTGCTGTGGTGTGCGGGGGTCCCATCCGTCACCTCTGACAACTCCCACACC
CTGTCCCAGGTGCCTTCCCCCCTCTGGATCATGCCCCCGGACGAGTACTGTCTCATGTGGGTCACTGCCGACCTGGTCTC
CTTCACCCTCATCGTGGGCATCTTCGTGCTCCAGAAGTGGCGCCTGGGTGGCATACGGAGCTACAACCCTGAGCAGATCA
TGCTGAGTGCTGCGGTGCGCCGGACCAGCCGGGACGTCAGCATCATGAAGGAGAAGCTTATTTTCTCAGAGATCAGCGAT
GGTGTAGAGGTCTCCGATGTGCTCTCCGTATGTTCAGACAACAGTTATGACACATATGCCAACAGCACCGCCACCCCTGT
GGGCCCCCGAGGGGGTGGCAGCCACACCAAGACCCTCATAGAGCGGAGTGGGCGTTAG

Protein (605aa)

>JHU11547
MVRHQPLQYYEPQLCLSCLTGIYGCRWKRYQRSHDDTTPWERLWFLLLTFTFGLTLTWLYFWWEVHNDYDEFNWYLYNRM
GYWSDWPVPILVTTAAAFAYIAGLLVLALCHIAVGQQMNLHWLHKIGLVVILASTVVAMSAVAQLWEDEWEVLLISLQGT
APFLHVGAVAAVTMLSWIVAGQFARAERTSSQVTILCTFFTVVFALYLAPLTISSPCIMEKKDLGPKPALIGHRGAPMLA
PEHTLMSFRKALEQKLYGLQADITISLDGVPFLMHDTTLRRTTNVEEEFPELARRPASMLNWTTLQRLNAGQWFLKTDPF
WTASSLSPSDHREAQNQSICSLAELLELAKGNATLLLNLRDPPREHPYRSSFINVTLEAVLHSGFPQHQVMWLPSRQRPL
VRKVAPGFQQTSGSKEAVASLRRGHIQRLNLRYTQVSRQELRDYASWNLSVNLYTVNAPWLFSLLWCAGVPSVTSDNSHT
LSQVPSPLWIMPPDEYCLMWVTADLVSFTLIVGIFVLQKWRLGGIRSYNPEQIMLSAAVRRTSRDVSIMKEKLIFSEISD
GVEVSDVLSVCSDNSYDTYANSTATPVGPRGGGSHTKTLIERSGR