Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11536 COMMD4 Homo sapiens Yes Metabolism; Nuclear Proteins

HuProt v2.0
Block Row Column Clone
2 16 9 JHU11536
2 16 10 JHU11536
HuProt v3.0
Block Row Column Clone
14 1 5 JHU11536
14 2 5 JHU11536
HuProt v3.1
Block Row Column Clone
14 1 5 JHU11536
14 2 5 JHU11536

External Database ID

Nucleotide (600bp)

>JHU11536
ATGAGGTTCCGGTTCTGTGGTGATCTGGACTGTCCCGACTGGGTCCTGGCAGAAATCAGCACGCTGGCCAAGATGTCCTC
TGTGAAGTTGCGGCTGCTCTGCAGCCAGGTACTAAAGGAGCTGCTGGGACAGGGGATTGATTATGAGAAGATCCTGAAGC
TCACGGCTGACGCCAAGTTTGAGTCAGGCGATGTGAAGGCCACAGTGGCAGTGCTGAGTTTCATCCTCTCCAGTGCGGCC
AAGCACAGTGTCGATGGCGAATCCTTGTCCAGTGAACTGCAGCAGCTGGGGCTGCCCAAAGAGCACGCGGCCAGCCTGTG
CCGCTGTTATGAGGAGAAGCAAAGCCCCTTGCAGAAGCACTTGCGGGTCTGCAGCCTACGCATGAATAGGTTGGCAGGTG
TGGGCTGGCGGGTGGACTACACCCTGAGCTCCAGCCTGCTGCAATCCGTGGAAGAGCCCATGGTGCACCTGCGGCTGGAG
GTGGCAGCTGCCCCAGGGACCCCAGCCCAGCCTGTTGCCATGTCCCTCTCAGCAGACAAGTTCCAGGTCCTCCTGGCAGA
ACTGAAGCAGGCCCAGACCCTGATGAGCTCCCTGGGCTAG

Protein (199aa)

>JHU11536
MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAA
KHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLE
VAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLMSSLG