Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11534 CCT8 C21orf112;CCTQ;KIAA0002 Homo sapiens Yes Cell Death

HuProt v2.0
Block Row Column Clone
12 16 13 JHU11534
12 16 14 JHU11534
HuProt v3.0
Block Row Column Clone
13 1 12 JHU11534
13 2 12 JHU11534
HuProt v3.1
Block Row Column Clone
13 1 12 JHU11534
13 2 12 JHU11534

External Database ID

Nucleotide (1647bp)

>JHU11534
ATGGCGCTTCACGTTCCCAAGGCTCCGGGCTTTGCCCAGATGCTCAAGGAGGGAGCGAAACACTTTTCAGGATTAGAAGA
GGCTGTGTATAGAAACATACAAGCTTGCAAGGAGCTTGCCCAAACCACTCGTACAGCATATGGACCAAATGGAATGAACA
AAATGGTTATCAACCACTTGGAGAAGTTGTTTGTGACAAACGATGCAGCAACTATTTTAAGAGAACTAGAAGTACAGCAT
CCTGCTGCAAAAATGATTGTAATGGCTTCTCATATGCAAGAGCAAGAAGTTGGAGATGGCACAAACTTTGTTCTGGTATT
TGCTGGAGCTCTCCTGGAATTAGCTGAAGAACTTCTGAGGATTGGCCTGTCAGTTTCAGAGGTCATAGAAGGTTATGAAA
TAGCCTGCAGAAAAGCTCATGAGATTCTTCCTAATTTGGTATGTTGTTCTGCAAAAAACCTTCGAGATATTGATGAAGTC
TCATCTCTACTTCGTACCTCCATAATGAGTAAACAATATGGTAATGAAGTATTTCTGGCCAAGCTTATTGCTCAGGCATG
CGTATCTATTTTTCCTGATTCCGGCCATTTCAATGTTGATAACATCAGAGTTTGTAAAATTCTGGGCTCTGGTATCAGTT
CCTCTTCAGTATTGCATGGCATGGTTTTTAAGAAGGAAACCGAAGGTGATGTAACATCTGTCAAAGATGCAAAAATAGCA
GTGTACTCTTGTCCTTTTGATGGCATGATAACAGAAACTAAGGGAACAGTGTTGATAAAGACTGCTGAAGAATTGATGAA
TTTTAGTAAGGGAGAAGAAAACCTCATGGATGCACAAGTCAAAGCTATTGCTGATACTGGTGCAAATGTCGTAGTAACAG
GTGGCAAAGTGGCAGACATGGCTCTTCATTATGCAAATAAATATAATATCATGTTAGTGAGGCTAAACTCAAAATGGGAT
CTCCGAAGACTTTGTAAAACTGTTGGTGCTACAGCTCTTCCTAGATTGACACCTCCTGTCCTTGAAGAAATGGGACACTG
TGACAGTGTTTACCTCTCAGAAGTTGGAGATACTCAGGTGGTGGTTTTTAAGCATGAAAAGGAAGATGGCGCCATTTCTA
CCATAGTACTTCGAGGCTCTACAGACAATCTGATGGATGACATAGAAAGGGCAGTAGACGATGGTGTTAATACTTTCAAA
GTTCTTACAAGGGATAAACGTCTTGTACCCGGAGGTGGAGCAACAGAAATTGAATTAGCCAAACAGATCACATCATATGG
AGAGACATGTCCTGGACTTGAACAGTATGCTATTAAGAAGTTTGCTGAGGCATTTGAAGCTATTCCCCGCGCACTGGCAG
AAAACTCTGGAGTTAAGGCCAATGAAGTAATCTCTAAACTTTATGCAGTACATCAAGAAGGAAATAAAAACGTTGGATTA
GATATTGAGGCTGAAGTCCCTGCTGTAAAGGACATGCTGGAAGCTGGTATTCTAGATACTTACCTGGGAAAATATTGGGC
TATCAAACTCGCTACTAATGCTGCAGTCACTGTACTTAGAGTGGATCAGATCATCATGGCAAAACCAGCTGGTGGGCCCA
AGCCTCCAAGTGGGAAGAAAGACTGGGATGATGACCAAAATGATTAG

Protein (548aa)

>JHU11534
MALHVPKAPGFAQMLKEGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAATILRELEVQH
PAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRIGLSVSEVIEGYEIACRKAHEILPNLVCCSAKNLRDIDEV
SSLLRTSIMSKQYGNEVFLAKLIAQACVSIFPDSGHFNVDNIRVCKILGSGISSSSVLHGMVFKKETEGDVTSVKDAKIA
VYSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIADTGANVVVTGGKVADMALHYANKYNIMLVRLNSKWD
LRRLCKTVGATALPRLTPPVLEEMGHCDSVYLSEVGDTQVVVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFK
VLTRDKRLVPGGGATEIELAKQITSYGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYAVHQEGNKNVGL
DIEAEVPAVKDMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKKDWDDDQND