Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11529 CAPS Homo sapiens Yes Signal Transduction

HuProt v2.0
Block Row Column Clone
20 16 1 JHU11529
20 16 2 JHU11529
HuProt v3.0
Block Row Column Clone
16 1 20 JHU11529
16 2 20 JHU11529
HuProt v3.1
Block Row Column Clone
16 1 20 JHU11529
16 2 20 JHU11529

External Database ID

Nucleotide (570bp)

>JHU11529
ATGGACGCCGTGGATGCCACCATGGAGAAACTCCGGGCACAGTGCCTGTCCCGCGGGGCCTCGGGCATCCAGGGCCTGGC
CAGGTTTTTCCGCCAACTAGACCGGGACGGGAGCAGATCCCTGGACGCTGATGAGTTCCGGCAGGGTCTGGCCAAACTCG
GGCTGGTGCTGGACCAGGCGGAGGCAGAGGGTGTGTGCAGGAAGTGGGACCGCAATGGCAGCGGGACGCTGGATCTGGAG
GAGTTCCTTCGGGCGCTGCGGCCCCCCATGTCCCAGGCCCGGGAGGCTGTCATCGCAGCTGCATTTGCCAAGCTGGACCG
CAGCGGGGACGGCGTCGTGACGGTGGACGACCTCCGCGGGGTGTACAGTGGCCGTGCCCACCCCAAGGTGCGCAGTGGGG
AGTGGACCGAGGACGAGGTGCTGCGCCGCTTCCTGGACAACTTCGACTCCTCTGAGAAGGACGGGCAGGTCACACTGGCG
GAATTCCAGGACTACTACAGCGGCGTGAGTGCCTCCATGAACACGGATGAGGAGTTCGTGGCCATGATGACCAGTGCCTG
GCAGCTGTAG

Protein (189aa)

>JHU11529
MDAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWDRNGSGTLDLE
EFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRGVYSGRAHPKVRSGEWTEDEVLRRFLDNFDSSEKDGQVTLA
EFQDYYSGVSASMNTDEEFVAMMTSAWQL