Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11528 STKLD1 C9orf96;SGK071 Homo sapiens Yes Kinases

HuProt v2.0
Block Row Column Clone
28 16 15 JHU11528
28 16 16 JHU11528
HuProt v3.0
Block Row Column Clone
13 5 12 JHU11528
13 6 12 JHU11528
HuProt v3.1
Block Row Column Clone
13 5 12 JHU11528
13 6 12 JHU11528

External Database ID

Nucleotide (2043bp)

>JHU11528
ATGCTTGGGCCAGGGTCCAATCGCAGGCGCCCCACGCAGGGGGAGCGAGGCCCAGGGTCCCCCGGAGAGCCCATGGAGAA
GTACCAGGTTTTGTACCAGCTGAATCCTGGGGCCTTGGGGGTGAACCTGGTGGTGGAGGAAATGGAAACCAAAGTCAAGC
ATGTGATAAAGCAGGTGGAATGCATGGATGACCATTACGCCAGTCAGGCCCTGGAGGAGCTGATGCCACTGCTGAAGCTG
CGGCACGCCCACATCTCTGTGTACCAGGAGCTGTTCATCACGTGGAATGGGGAGATCTCTTCTCTGTACCTCTGCCTGGT
GATGGAGTTCAATGAGCTCAGCTTCCAGGAGGTCATTGAGGATAAGAGGAAGGCAAAGAAAATCATTGACTCTGAGTGGA
TGCAGAATGTGCTGGGCCAGGTGCTGGACGCGCTGGAATACCTGCACCATTTGGACATCATCCACAGGAATCTCAAACCC
TCCAACATCATCCTCATCAGCAGTGACCACTGCAAACTGCAGGACCTGAGTTCCAATGTGCTAATGACAGACAAAGCCAA
ATGGAATATTCGTGCGGAGGAAGACCCCTTTCGTAAGTCCTGGATGGCCCCTGAAGCCCTCAACTTCTCCTTCAGCCAGA
AATCAGACATCTGGTCCCTGGGCTGCATCATTCTGGACATGACCAGCTGCTCCTTCATGGATGGCACAGAAGCCATGCAT
CTGCGGAAGTCCCTCCGCCAGAGCCCAGGCAGCCTGAAGGCCGTCCTGAAGACAATGGAGGAGAAGCAGATCCCGGATGT
GGAAACCTTCAGGAATCTTCTGCCCTTGATGCTCCAGATCGACCCCTCGGATCGAATAACGATAAAGGACGTGGTGCACA
TCACCTTCTTGAGAGGCTCCTTCAAGTCCTCGTGCGTCTCTCTGACCCTGCACCGGCAGATGGTGCCTGCGTCCATCACC
GACATGCTGTTAGAAGGCAACGTGGCCAGCATTTTAGAGGTCATGCAGAAATTCTCTGGCTGGCCCGAAGTCCAGCTCAG
GGCCATGAAGAGGCTTCTGAAAATGCCTGCAGATCAGCTAGGTCTGCCGTGGCCCCCGGAGCTGGTGGAGGTGGTGGTCA
CGACCATGGAGCTACATGACAGGGTCCTCGATGTCCAGCTGTGTGCCTGCTCCCTGCTGCTGCACCTCCTGGGCCAAGCG
CTGGTGCACCACCCGGAAGCCAAGGCTCCCTGCAACCAAGCCATCACCTCCACCCTGCTGAGTGCTCTTCAGAGCCACCC
CGAGGAGGAGCCACTTCTTGTCATGGTCTACAGCCTGCTAGCCATCACCACAACCCAGGAGTCAGAGTCACTGTCAGAGG
AGCTGCAGAACGCTGGGCTGCTGGAGCACATCCTGGAGCACCTCAACAGCTCCCTCGAAAGCAGGGACGTCTGCGCCAGC
GGCCTGGGCCTGCTCTGGGCCCTCCTGCTGGACGGTATCATTGTGAACAAGGCCCCCTTGGAGAAGGTCCCGGACCTCAT
CAGCCAGGTGTTGGCCACCTACCCTGCGGATGGGGAAATGGCAGAAGCCAGCTGCGGAGTCTTCTGGCTGCTGTCCCTGC
TGGGCTGCATCAAGGAGCAGCAGTTTGAACAAGTGGTGGCGCTGCTCCTGCAAAGCATCCGGCTGTGCCAGGACAGAGCC
CTGCTGGTGAACAATGCCTACCGGGGACTGGCCAGCCTGGTGAAGGTGTCAGAGCTGGCGGCCTTCAAGGTGGTGGTGCA
GGAGGAGGGCGGCAGTGGCCTCAGCCTCATCAAGGAGACCTACCAGCTCCACAGGGACGACCCGGAGGTGGTGGAGAACG
TGGGCATGCTGCTGGTCCACCTGGCTTCCTATGAGGAGATCCTGCCGGAGCTGGTGTCCAGTAGTATGAAGGCCCTGCTC
CAGGAGATCAAGGAGCGCTTCACCTCCAGCCTGGTGAGTGACAGCAGCGCCTTCAGCAAACCAGGCCTCCCTCCAGGTGG
AAGCCCCCAGCTGGGGTGCACCACGTCTGGGGGACTGGAATAG

Protein (680aa)

>JHU11528
MLGPGSNRRRPTQGERGPGSPGEPMEKYQVLYQLNPGALGVNLVVEEMETKVKHVIKQVECMDDHYASQALEELMPLLKL
RHAHISVYQELFITWNGEISSLYLCLVMEFNELSFQEVIEDKRKAKKIIDSEWMQNVLGQVLDALEYLHHLDIIHRNLKP
SNIILISSDHCKLQDLSSNVLMTDKAKWNIRAEEDPFRKSWMAPEALNFSFSQKSDIWSLGCIILDMTSCSFMDGTEAMH
LRKSLRQSPGSLKAVLKTMEEKQIPDVETFRNLLPLMLQIDPSDRITIKDVVHITFLRGSFKSSCVSLTLHRQMVPASIT
DMLLEGNVASILEVMQKFSGWPEVQLRAMKRLLKMPADQLGLPWPPELVEVVVTTMELHDRVLDVQLCACSLLLHLLGQA
LVHHPEAKAPCNQAITSTLLSALQSHPEEEPLLVMVYSLLAITTTQESESLSEELQNAGLLEHILEHLNSSLESRDVCAS
GLGLLWALLLDGIIVNKAPLEKVPDLISQVLATYPADGEMAEASCGVFWLLSLLGCIKEQQFEQVVALLLQSIRLCQDRA
LLVNNAYRGLASLVKVSELAAFKVVVQEEGGSGLSLIKETYQLHRDDPEVVENVGMLLVHLASYEEILPELVSSSMKALL
QEIKERFTSSLVSDSSAFSKPGLPPGGSPQLGCTTSGGLE