Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11524 BID Homo sapiens Yes Cell Death; Signal Transduction

HuProt v2.0
Block Row Column Clone
36 16 15 JHU11524
36 16 16 JHU11524
HuProt v3.0
Block Row Column Clone
13 5 20 JHU11524
13 6 20 JHU11524
HuProt v3.1
Block Row Column Clone
13 5 20 JHU11524
13 6 20 JHU11524

External Database ID

Nucleotide (300bp)

>JHU11524
ATGGACCGTAGCATCCCTCCGGGCCTGGTGAACGGCCTGGCCCTGCAGCTCAGGAACACCAGCCGGTCGGAGGAGGACCG
GAACAGGGACCTGGCCACTGCCCTGGAGCAGCTGCTGCAGGCCTACCCTAGAGACATGGAGAAGGAGAAGACCATGCTGG
TGCTGGCCCTGCTGCTGGCCAAGAAGGTGGCCAGTCACACGCCGTCCTTGCTCCGTGATGTCTTTCACACAACAGTGAAT
TTTATTAACCAGAACCTACGCACCTACGTGAGGAGCTTAGCCAGAAATGGGATGGACTAG

Protein (99aa)

>JHU11524
MDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVN
FINQNLRTYVRSLARNGMD