Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00115 CDKN2B MTS2 Homo sapiens Yes Kinases

HuProt v2.0
Block Row Column Clone
6 1 5 JHU00115
6 1 6 JHU00115
HuProt v3.0
Block Row Column Clone
3 1 9 JHU00115
3 2 9 JHU00115
HuProt v3.1
Block Row Column Clone
3 1 9 JHU00115
3 2 9 JHU00115

External Database ID

Nucleotide (417bp)

>JHU00115
ATGCGCGAGGAGAACAAGGGCATGCCCAGTGGGGGCGGCAGCGATGAGGGTCTGGCCAGCGCCGCGGCGCGGGGACTAGT
GGAGAAGGTGCGACAGCTCCTGGAAGCCGGCGCGGATCCCAACGGAGTCAACCGTTTCGGGAGGCGCGCGATCCAGGTCA
TGATGATGGGCAGCGCCCGCGTGGCGGAGCTGCTGCTGCTCCACGGCGCGGAGCCCAACTGCGCAGACCCTGCCACTCTC
ACCCGACCGGTGCATGATGCTGCCCGGGAGGGCTTCCTGGACACGCTGGTGGTGCTGCACCGGGCCGGGGCGCGGCTGGA
CGTGCGCGATGCCTGGGGTCGTCTGCCCGTGGACTTGGCCGAGGAGCGGGGCCACCGCGACGTTGCAGGGTACCTGCGCA
CAGCCACGGGGGACTAG

Protein (138aa)

>JHU00115
MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATL
TRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD