Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00110 CAMK4 CAMK;CAMK-GR;CAMKIV Homo sapiens Yes Kinases; Nuclear Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
6 1 13 JHU00110
6 1 14 JHU00110
HuProt v3.0
Block Row Column Clone
1 1 9 JHU00110
1 2 9 JHU00110
HuProt v3.1
Block Row Column Clone
1 1 9 JHU00110
1 2 9 JHU00110

External Database ID

Nucleotide (1422bp)

>JHU00110
ATGCTCAAAGTCACGGTGCCCTCCTGCTCCGCCTCGTCCTGCTCTTCGGTCACCGCCAGTGCGGCCCCGGGGACCGCGAG
CCTCGTCCCGGATTACTGGATCGACGGCTCCAACAGGGATGCGCTGAGCGATTTCTTCGAGGTGGAGTCGGAGCTGGGAC
GGGGTGCTACATCCATTGTGTACAGATGCAAACAGAAGGGGACCCAGAAGCCTTATGCTCTCAAAGTGTTAAAGAAAACA
GTGGACAAAAAAATCGTAAGAACTGAGATAGGAGTTCTTCTTCGCCTCTCACATCCAAACATTATAAAACTTAAAGAGAT
ATTTGAAACCCCTACAGAAATCAGTCTGGTCCTAGAACTCGTCACAGGAGGAGAACTGTTTGATAGGATTGTGGAAAAGG
GATATTACAGTGAGCGAGATGCTGCAGATGCCGTTAAACAAATCCTGGAGGCAGTTGCTTATCTACATGAAAATGGGATT
GTCCATCGTGATCTCAAACCAGAGAATCTTCTTTATGCAACTCCAGCCCCAGATGCACCACTCAAAATCGCTGATTTTGG
ACTCTCTAAAATTGTGGAACATCAAGTGCTCATGAAGACAGTATGTGGAACCCCAGGGTACTGCGCACCTGAAATTCTTA
GAGGTTGTGCCTATGGACCTGAGGTGGACATGTGGTCTGTAGGAATAATCACCTACATCTTACTTTGTGGATTTGAACCA
TTCTATGATGAAAGAGGCGATCAGTTCATGTTCAGGAGAATTCTGAATTGTGAATATTACTTTATCTCCCCCTGGTGGGA
TGAAGTATCTCTAAATGCCAAGGACTTGGTCAGAAAATTAATTGTTTTGGATCCAAAGAAACGGCTGACTACATTTCAAG
CTCTCCAGCATCCGTGGGTCACAGGTAAAGCAGCCAATTTTGTACACATGGATACCGCTCAAAAGAAGCTCCAAGAATTC
AATGCCCGGCGTAAGCTTAAGGCAGCGGTGAAGGCTGTGGTGGCCTCTTCCCGCCTGGGAAGTGCCAGCAGCAGCCATGG
CAGCATCCAGGAGAGCCACAAGGCTAGCCGAGACCCTTCTCCAATCCAAGATGGCAACGAGGACATGAAAGCTATTCCAG
AAGGAGAGAAAATTCAAGGCGATGGGGCCCAAGCCGCAGTTAAGGGGGCACAGGCTGAGCTGATGAAGGTGCAAGCCTTA
GAGAAAGTTAAAGGTGCAGATATAAATGCTGAAGAGGCCCCCAAAATGGTGCCCAAGGCAGTGGAGGATGGGATAAAGGT
GGCTGACCTGGAACTAGAGGAGGGCCTAGCAGAGGAGAAGCTGAAGACTGTGGAGGAGGCAGCAGCTCCCAGAGAAGGGC
AAGGAAGCTCTGCTGTGGGTTTTGAAGTTCCACAGCAAGATGTGATCCTGCCAGAGTACTAG

Protein (473aa)

>JHU00110
MLKVTVPSCSASSCSSVTASAAPGTASLVPDYWIDGSNRDALSDFFEVESELGRGATSIVYRCKQKGTQKPYALKVLKKT
VDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGI
VHRDLKPENLLYATPAPDAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEP
FYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEF
NARRKLKAAVKAVVASSRLGSASSSHGSIQESHKASRDPSPIQDGNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQAL
EKVKGADINAEEAPKMVPKAVEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY