Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00011 CAPN6 CALPM;CANPX Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
18 1 1 JHU00011
18 1 2 JHU00011
HuProt v3.0
Block Row Column Clone
4 1 3 JHU00011
4 2 3 JHU00011
HuProt v3.1
Block Row Column Clone
4 1 3 JHU00011
4 2 3 JHU00011

External Database ID

Nucleotide (1926bp)

>JHU00011
ATGGGTCCTCCTCTGAAGCTCTTCAAAAACCAGAAATACCAGGAACTGAAGCAGGAATGCATCAAAGACAGCAGACTTTT
CTGTGATCCAACATTTCTGCCTGAGAATGATTCTCTTTTCTACAACCGACTGCTTCCTGGAAAGGTGGTGTGGAAACGTC
CCCAGGACATCTGTGATGACCCCCATCTGATTGTGGGCAACATTAGCAACCACCAGCTGACCCAAGGGAGACTGGGGCAC
AAGCCAATGGTTTCTGCATTTTCCTGTTTGGCTGTTCAGGAGTCTCATTGGACAAAGACAATTCCCAACCATAAGGAACA
GGAATGGGACCCTCAAAAAACAGAAAAATACGCTGGGATATTTCACTTTCGTTTCTGGCATTTTGGAGAATGGACTGAAG
TGGTGATTGATGACTTGTTGCCCACCATTAACGGAGATCTGGTCTTCTCTTTCTCCACTTCCATGAATGAGTTTTGGAAT
GCTCTGCTGGAAAAAGCTTATGCAAAGCTGCTAGGCTGTTATGAGGCCCTGGATGGTTTGACCATCACTGATATTATTGT
GGACTTCACGGGCACATTGGCTGAAACTGTTGACATGCAGAAAGGAAGATACACTGAGCTTGTTGAGGAGAAGTACAAGC
TATTCGGAGAACTGTACAAAACATTTACCAAAGGTGGTCTGATCTGCTGTTCCATTGAGTCTCCCAATCAGGAGGAGCAA
GAAGTTGAAACTGATTGGGGTCTGCTGAAGGGCCATACCTATACCATGACAGATATTCGCAAAATTCGTCTTGGAGAGAG
ACTTGTGGAAGTCTTCAGTGCTGAGAAGGTGTATATGGTTCGCCTGAGAAACCCCTTGGGAAGACAGGAATGGAGTGGCC
CCTGGAGTGAAATTTCTGAAGAGTGGCAGCAACTGACTGCATCAGATCGCAAGAACCTGGGGCTTGTTATGTCTGATGAT
GGAGAGTTTTGGATGAGCTTGGAGGACTTTTGCCGCAACTTTCACAAACTGAATGTCTGCCGCAATGTGAACAACCCTAT
TTTTGGCCGAAAGGAGCTGGAATCGGTGTTGGGATGCTGGACTGTGGATGATGATCCCCTGATGAACCGCTCAGGAGGCT
GCTATAACAACCGTGATACCTTCCTGCAGAATCCCCAGTACATCTTCACTGTGCCTGAGGATGGGCACAAGGTCATTATG
TCACTGCAGCAGAAGGACCTGCGCACTTACCGCCGAATGGGAAGACCTGACAATTACATCATTGGCTTTGAGCTCTTCAA
GGTGGAGATGAACCGCAAATTCCGCCTCCACCACCTCTACATCCAGGAGCGTGCTGGGACTTCCACCTATATTGACACCC
GCACAGTGTTTCTGAGCAAGTACCTGAAGAAGGGCAACTATGTGCTTGTCCCAACCATGTTCCAGCATGGTCGCACCAGC
GAGTTTCTCCTGAGAATCTTCTCTGAAGTGCCTGTCCAGCTCAGGGAACTGACTCTGGACATGCCCAAAATGTCCTGCTG
GAACCTGGCTCGTGGCTACCCGAAAGTAGTTACTCAGATCACTGTTCACAGTGCTGAGGACCTGGAGAAGAAGTATGCCA
ATGAAACTGTAAACCCATATTTGGTCATCAAATGTGGAAAGGAGGAAGTCCGTTCTCCTGTCCAGAAGAATACAGTTCAT
GCCATTTTTGACACCCAGGCCATTTTCTACAGAAGGACCACTGACATTCCTATTATAGTACAGGTCTGGAACAGCCGAAA
ATTCTGTGATCAGTTCTTGGGGCAGGTTACTCTGGATGCTGACCCCAGCGACTGCCGTGATCTGAAGTCTCTGTACCTGC
GTAAGAAGGGTGGTCCAACTGCCAAAGTCAAGCAAGGCCACATCAGCTTCAAGGTTATTTCCAGCGATGATCTCACTGAG
CTCTAG

Protein (641aa)

>JHU00011
MGPPLKLFKNQKYQELKQECIKDSRLFCDPTFLPENDSLFYNRLLPGKVVWKRPQDICDDPHLIVGNISNHQLTQGRLGH
KPMVSAFSCLAVQESHWTKTIPNHKEQEWDPQKTEKYAGIFHFRFWHFGEWTEVVIDDLLPTINGDLVFSFSTSMNEFWN
ALLEKAYAKLLGCYEALDGLTITDIIVDFTGTLAETVDMQKGRYTELVEEKYKLFGELYKTFTKGGLICCSIESPNQEEQ
EVETDWGLLKGHTYTMTDIRKIRLGERLVEVFSAEKVYMVRLRNPLGRQEWSGPWSEISEEWQQLTASDRKNLGLVMSDD
GEFWMSLEDFCRNFHKLNVCRNVNNPIFGRKELESVLGCWTVDDDPLMNRSGGCYNNRDTFLQNPQYIFTVPEDGHKVIM
SLQQKDLRTYRRMGRPDNYIIGFELFKVEMNRKFRLHHLYIQERAGTSTYIDTRTVFLSKYLKKGNYVLVPTMFQHGRTS
EFLLRIFSEVPVQLRELTLDMPKMSCWNLARGYPKVVTQITVHSAEDLEKKYANETVNPYLVIKCGKEEVRSPVQKNTVH
AIFDTQAIFYRRTTDIPIIVQVWNSRKFCDQFLGQVTLDADPSDCRDLKSLYLRKKGGPTAKVKQGHISFKVISSDDLTE
L