Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00106 BMX Homo sapiens Yes Cell Death; Kinases; Signal Transduction; Transcription Factors

HuProt v2.0
Block Row Column Clone
14 1 5 JHU00106
14 1 6 JHU00106
HuProt v3.0
Block Row Column Clone
3 1 29 JHU00106
3 2 29 JHU00106
HuProt v3.1
Block Row Column Clone
3 1 29 JHU00106
3 2 29 JHU00106

External Database ID

Nucleotide (2028bp)

>JHU00106
ATGGATACAAAATCTATTCTAGAAGAACTTCTTCTCAAAAGATCACAGCAAAAGAAGAAAATGTCACCAAATAATTACAA
AGAACGGCTTTTTGTTTTGACCAAAACAAACCTTTCCTACTATGAATATGACAAAATGAAAAGGGGCAGCAGAAAAGGAT
CCATTGAAATTAAGAAAATCAGATGTGTGGAGAAAGTAAATCTCGAGGAGCAGACGCCTGTAGAGAGACAGTACCCATTT
CAGATTGTCTATAAAGATGGGCTTCTCTATGTCTATGCATCAAATGAAGAGAGCCGAAGTCAGTGGTTGAAAGCATTACA
AAAAGAGATAAGGGGTAACCCCCACCTGCTGGTCAAGTACCATAGTGGGTTCTTCGTGGACGGGAAGTTCCTGTGTTGCC
AGCAGAGCTGTAAAGCAGCCCCAGGATGTACCCTCTGGGAAGCATATGCTAATCTGCATACTGCAGTCAATGAAGAGAAA
CACAGAGTTCCCACCTTCCCAGACAGAGTGCTGAAGATACCTCGGGCAGTTCCTGTTCTCAAAATGGATGCACCATCTTC
AAGTACCACTCTAGCCCAATATGACAACGAATCAAAGAAAAACTATGGCTCCCAGCCACCATCTTCAAGTACCAGTCTAG
CGCAATATGACAGCAACTCAAAGAAAATCTATGGCTCCCAGCCAAACTTCAACATGCAGTATATTCCAAGGGAAGACTTC
CCTGACTGGTGGCAAGTAAGAAAACTGAAAAGTAGCAGCAGCAGTGAAGATGTTGCAAGCAGTAACCAAAAAGAAAGAAA
TGTGAATCACACCACCTCAAAGATTTCATGGGAATTCCCTGAGTCAAGTTCATCTGAAGAAGAGGAAAACCTGGATGATT
ATGACTGGTTTGCTGGTAACATCTCCAGATCACAATCTGAACAGTTACTCAGACAAAAGGGAAAAGAAGGAGCATTTATG
GTTAGAAATTCGAGCCAAGTGGGAATGTACACAGTGTCCTTATTTAGTAAGGCTGTGAATGATAAAAAAGGAACTGTCAA
ACATTACCACGTGCATACAAATGCTGAGAACAAATTATACCTGGCAGAAAACTACTGTTTTGATTCCATTCCAAAGCTTA
TTCATTATCATCAACACAATTCAGCAGGCATGATCACACGGCTCCGCCACCCTGTGTCAACAAAGGCCAACAAGGTCCCC
GACTCTGTGTCCCTGGGAAATGGAATCTGGGAACTGAAAAGAGAAGAGATTACCTTGTTGAAGGAGCTGGGAAGTGGCCA
GTTTGGAGTGGTCCAGCTGGGCAAGTGGAAGGGGCAGTATGATGTTGCTGTTAAGATGATCAAGGAGGGCTCCATGTCAG
AAGATGAATTCTTTCAGGAGGCCCAGACTATGATGAAACTCAGCCATCCCAAGCTGGTTAAATTCTATGGAGTGTGTTCA
AAGGAATACCCCATATACATAGTGACTGAATATATAAGCAATGGCTGCTTGCTGAATTACCTGAGGAGTCACGGAAAAGG
ACTTGAACCTTCCCAGCTCTTAGAAATGTGCTACGATGTCTGTGAAGGCATGGCCTTCTTGGAGAGTCACCAATTCATAC
ACCGGGACTTGGCTGCTCGTAACTGCTTGGTGGACAGAGATCTCTGTGTGAAAGTATCTGACTTTGGAATGACAAGGTAT
GTTCTTGATGACCAGTATGTCAGTTCAGTCGGAACAAAGTTTCCAGTCAAGTGGTCAGCTCCAGAGGTGTTTCATTACTT
CAAATACAGCAGCAAGTCAGACGTATGGGCATTTGGGATCCTGATGTGGGAGGTGTTCAGCCTGGGGAAGCAGCCCTATG
ACTTGTATGACAACTCCCAGGTGGTTCTGAAGGTCTCCCAGGGCCACAGGCTTTACCGGCCCCACCTGGCATCGGACACC
ATCTACCAGATCATGTACAGCTGCTGGCACGAGCTTCCAGAAAAGCGTCCCACATTTCAGCAACTCCTGTCTTCCATTGA
ACCACTTCGGGAAAAAGACAAGCATTAG

Protein (675aa)

>JHU00106
MDTKSILEELLLKRSQQKKKMSPNNYKERLFVLTKTNLSYYEYDKMKRGSRKGSIEIKKIRCVEKVNLEEQTPVERQYPF
QIVYKDGLLYVYASNEESRSQWLKALQKEIRGNPHLLVKYHSGFFVDGKFLCCQQSCKAAPGCTLWEAYANLHTAVNEEK
HRVPTFPDRVLKIPRAVPVLKMDAPSSSTTLAQYDNESKKNYGSQPPSSSTSLAQYDSNSKKIYGSQPNFNMQYIPREDF
PDWWQVRKLKSSSSSEDVASSNQKERNVNHTTSKISWEFPESSSSEEEENLDDYDWFAGNISRSQSEQLLRQKGKEGAFM
VRNSSQVGMYTVSLFSKAVNDKKGTVKHYHVHTNAENKLYLAENYCFDSIPKLIHYHQHNSAGMITRLRHPVSTKANKVP
DSVSLGNGIWELKREEITLLKELGSGQFGVVQLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCS
KEYPIYIVTEYISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDRDLCVKVSDFGMTRY
VLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSQVVLKVSQGHRLYRPHLASDT
IYQIMYSCWHELPEKRPTFQQLLSSIEPLREKDKH