Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU10541 PRKD2 PKD2 Homo sapiens Yes Cell Death; Kinases; Membrane Proteins; Nuclear Proteins; Signal Transduction; Transcription Factors

HuProt v2.0
Block Row Column Clone
32 1 5 JHU10541
32 1 6 JHU10541
24 14 17 JHU10541
24 14 18 JHU10541
HuProt v3.0
Block Row Column Clone
3 1 32 JHU10541
3 2 32 JHU10541
12 43 22 JHU10541
12 44 22 JHU10541
HuProt v3.1
Block Row Column Clone
3 1 32 JHU10541
3 2 32 JHU10541
12 43 22 JHU10541
12 44 22 JHU10541

External Database ID

Nucleotide (2637bp)

>JHU10541
ATGGCCACCGCCCCCTCTTATCCCGCCGGGCTCCCTGGCTCTCCCGGGCCGGGGTCTCCTCCGCCCCCCGGCGGCCTAGA
GCTGCAGTCGCCGCCACCGCTACTGCCCCAGATCCCGGCCCCGGGTTCCGGGGTCTCCTTTCACATCCAGATCGGGCTGA
CCCGCGAGTTCGTGCTGTTGCCCGCCGCCTCCGAGCTGGCTCATGTGAAGCAGCTGGCCTGTTCCATCGTGGACCAGAAG
TTCCCTGAGTGTGGCTTCTACGGCCTTTACGACAAGATCCTGCTTTTCAAACATGACCCCACGTCGGCCAACCTCCTGCA
GCTGGTGCGCTCGTCCGGAGACATCCAGGAGGGCGACCTGGTGGAGGTGGTGCTGTCGGCCTCGGCCACCTTCGAGGACT
TCCAGATCCGCCCGCACGCCCTCACGGTGCACTCCTATCGGGCGCCTGCCTTCTGTGATCACTGCGGGGAGATGCTCTTC
GGCCTAGTGCGCCAGGGCCTCAAGTGCGATGGCTGCGGGCTGAACTACCACAAGCGCTGTGCCTTCAGCATCCCCAACAA
CTGTAGTGGGGCCCGCAAACGGCGCCTGTCATCCACGTCTCTGGCCAGTGGCCACTCGGTGCGCCTCGGCACCTCCGAGT
CCCTGCCCTGCACGGCTGAAGAGCTGAGCCGTAGCACCACCGAACTCCTGCCTCGCCGTCCCCCGTCATCCTCTTCCTCC
TCTTCTGCCTCATCGTATACGGGCCGCCCCATTGAGCTGGACAAGATGCTGCTCTCCAAGGTCAAGGTGCCGCACACCTT
CCTCATCCACAGCTATACACGGCCCACCGTTTGCCAGGCTTGCAAGAAACTCCTCAAGGGCCTCTTCCGGCAGGGCCTGC
AATGCAAAGACTGCAAGTTTAACTGTCACAAACGCTGCGCCACCCGCGTCCCTAATGACTGCCTGGGGGAGGCCCTTATC
AATGGAGATGTGCCGATGGAGGAGGCCACCGATTTCAGCGAGGCTGACAAGAGCGCCCTCATGGATGAGTCAGAGGACTC
CGGTGTCATCCCTGGCTCCCACTCAGAGAATGCGCTCCACGCCAGTGAGGAGGAGGAAGGCGAGGGAGGCAAGGCCCAGA
GCTCCCTGGGGTACATCCCCCTAATGAGGGTGGTGCAATCGGTGCGACACACGACGCGGAAATCCAGCACCACGCTGCGG
GAGGGTTGGGTGGTTCATTACAGCAACAAGGACACGCTGAGAAAGCGGCACTATTGGCGCCTGGACTGCAAGTGTATCAC
GCTCTTCCAGAACAACACGACCAACAGATACTATAAGGAAATTCCGCTGTCAGAAATCCTCACGGTGGAGTCCGCCCAGA
ACTTCAGCCTTGTGCCGCCGGGCACCAACCCACACTGCTTTGAGATCGTCACTGCCAATGCCACCTACTTCGTGGGCGAG
ATGCCTGGCGGGACTCCGGGTGGGCCAAGTGGGCAGGGGGCTGAGGCCGCCCGGGGCTGGGAGACAGCCATCCGCCAGGC
CCTGATGCCCGTCATCCTTCAGGACGCACCCAGCGCCCCAGGCCACGCGCCCCACAGACAAGCTTCTCTGAGCATCTCTG
TGTCCAACAGTCAGATCCAAGAGAATGTGGACATTGCCACTGTCTACCAGATCTTCCCTGACGAAGTGCTGGGCTCAGGG
CAGTTTGGAGTGGTCTATGGAGGAAAACACCGGAAGACAGGCCGGGACGTGGCAGTTAAGGTCATTGACAAACTGCGCTT
CCCTACCAAGCAGGAGAGCCAGCTCCGGAATGAAGTGGCCATTCTGCAGAGCCTGCGGCATCCCGGGATCGTGAACCTGG
AGTGCATGTTCGAGACGCCTGAGAAAGTGTTTGTGGTGATGGAGAAGCTGCATGGGGACATGTTGGAGATGATCCTGTCC
AGTGAGAAGGGCCGGCTGCCTGAGCGCCTCACCAAGTTCCTCATCACCCAGATCCTGGTGGCTTTGAGACACCTTCACTT
CAAGAACATTGTCCACTGTGACTTGAAACCAGAAAACGTGTTGCTGGCATCAGCAGACCCATTTCCTCAGGTGAAGCTGT
GTGACTTTGGCTTTGCTCGCATCATCGGCGAGAAGTCGTTCCGCCGCTCAGTGGTGGGCACGCCGGCCTACCTGGCACCC
GAGGTGCTGCTCAACCAGGGCTACAACCGCTCGCTGGACATGTGGTCAGTGGGCGTGATCATGTACGTCAGCCTCAGCGG
CACCTTCCCTTTCAACGAGGATGAGGACATCAATGACCAGATCCAGAACGCCGCCTTCATGTACCCGGCCAGCCCCTGGA
GCCACATCTCAGCTGGAGCCATTGACCTCATCAACAACCTGCTGCAGGTGAAGATGCGCAAACGCTACAGCGTGGACAAA
TCTCTCAGCCACCCCTGGTTACAGGAGTACCAGACGTGGCTGGACCTCCGAGAGCTGGAGGGGAAGATGGGAGAGCGATA
CATCACGCATGAGAGTGACGACGCGCGCTGGGAGCAGTTTGCAGCAGAGCATCCGCTGCCTGGGTCTGGGCTGCCCACGG
ACAGGGATCTCGGTGGGGCCTGTCCACCACAGGACCACGACATGCAGGGGCTGGCGGAGCGCATCAGTGTTCTCTAG

Protein (878aa)

>JHU10541
MATAPSYPAGLPGSPGPGSPPPPGGLELQSPPPLLPQIPAPGSGVSFHIQIGLTREFVLLPAASELAHVKQLACSIVDQK
FPECGFYGLYDKILLFKHDPTSANLLQLVRSSGDIQEGDLVEVVLSASATFEDFQIRPHALTVHSYRAPAFCDHCGEMLF
GLVRQGLKCDGCGLNYHKRCAFSIPNNCSGARKRRLSSTSLASGHSVRLGTSESLPCTAEELSRSTTELLPRRPPSSSSS
SSASSYTGRPIELDKMLLSKVKVPHTFLIHSYTRPTVCQACKKLLKGLFRQGLQCKDCKFNCHKRCATRVPNDCLGEALI
NGDVPMEEATDFSEADKSALMDESEDSGVIPGSHSENALHASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLR
EGWVVHYSNKDTLRKRHYWRLDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGE
MPGGTPGGPSGQGAEAARGWETAIRQALMPVILQDAPSAPGHAPHRQASLSISVSNSQIQENVDIATVYQIFPDEVLGSG
QFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEVAILQSLRHPGIVNLECMFETPEKVFVVMEKLHGDMLEMILS
SEKGRLPERLTKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAP
EVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDINDQIQNAAFMYPASPWSHISAGAIDLINNLLQVKMRKRYSVDK
SLSHPWLQEYQTWLDLRELEGKMGERYITHESDDARWEQFAAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERISVL