Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU10533 NDFIP1 N4WBP5 Homo sapiens Yes Kinases; Secreted Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
28 1 9 JHU10533
28 1 10 JHU10533
38 14 17 JHU10533
38 14 18 JHU10533
21 24 25 JHU10533
21 24 26 JHU10533
HuProt v3.0
Block Row Column Clone
2 1 26 JHU10533
2 2 26 JHU10533
12 45 9 JHU10533
12 46 9 JHU10533
18 43 21 JHU10533
18 44 21 JHU10533
HuProt v3.1
Block Row Column Clone
2 1 26 JHU10533
2 2 26 JHU10533
12 45 9 JHU10533
12 46 9 JHU10533
18 43 21 JHU10533
18 44 21 JHU10533

External Database ID

Nucleotide (666bp)

>JHU10533
ATGGCGTTGGCGTTGGCGGCGCTGGCGGCGGTCGAGCCGGCCTGCGGCAGCCGGTACCAGCAGTTGCAGAATGAAGAAGA
GTCTGGAGAACCTGAACAGGCTGCAGGTGATGCTCCTCCACCTTACAGCAGCATTTCTGCAGAGAGCGCAGCATATTTTG
ACTACAAGGATGAGTCTGGGTTTCCAAAGCCCCCATCTTACAATGTAGCTACAACACTGCCCAGTTATGATGAAGCGGAG
AGGACCAAGGCTGAAGCTACTATCCCTTTGGTTCCTGGGAGAGATGAGGATTTTGTGGGTCGGGATGATTTTGATGATGC
TGACCAGCTGAGGATAGGAAATGATGGGATTTTCATGTTAACTTTTTTCATGGCATTCCTCTTTAACTGGATTGGGTTTT
TCCTGTCTTTTTGCCTGACCACTTCAGCTGCAGGAAGGTATGGGGCCATTTCAGGATTTGGTCTCTCTCTAATTAAATGG
ATCCTGATTGTCAGGTTTTCCACCTATTTCCCTGGATATTTTGATGGTCAGTACTGGCTCTGGTGGGTGTTCCTTGTTTT
AGGCTTTCTCCTGTTTCTCAGAGGATTTATCAATTATGCAAAAGTTCGGAAGATGCCAGAAACTTTCTCAAATCTCCCCA
GGACCAGAGTTCTCTTTATTTATTAG

Protein (221aa)

>JHU10533
MALALAALAAVEPACGSRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAE
RTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKW
ILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY