Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00105 ARHGAP29 PARG1 Homo sapiens Yes Signal Transduction

HuProt v2.0
Block Row Column Clone
8 1 1 JHU00105
8 1 2 JHU00105
HuProt v3.0
Block Row Column Clone
4 1 8 JHU00105
4 2 8 JHU00105
HuProt v3.1
Block Row Column Clone
4 1 8 JHU00105
4 2 8 JHU00105

External Database ID

Nucleotide (1182bp)

>JHU00105
ATGATTGCTCACAAACAGAAAAAGACAAAGAAAAAACGTGCTTGGGCATCAGGTCAACTCTCTACTGATATTACAACTTC
TGAAATGGGGCTCAAGTCCTTAAGTTCCAACTCTATTTTTGATCCGGATTACATCAAGGAGTTGGTGAATGATATCAGGA
AGTTCTCCCACATGTTACTATATTTGAAAGAAGCCATATTTTCAGACTGTTTTAAAGAAGTTATTCATATACGTCTAGAG
GAACTGCTCCGTGTTTTAAAGTCTATAATGAATAAACATCAGAACCTCAATTCTGTTGATCTTCAAAATGCTGCAGAAAT
GCTCACTGCAAAAGTGAAAGCTGTGAACTTCACAGAAGTTAATGAAGAAAACAAAAACGATCTCTTCCAGGAAGTGTTTT
CTTCTATTGAAACTTTGGCATTTACCTTTGGAAATATCCTTACAAACTTCCTTATGGGAGATGTAGGCAATGATTCATTA
TTGCGACTGCCTGTTTCTCGAGAAACTAAGTCGTTTGAAAATGTTTCTGTGGAATCAGTGGACTCATCCAGTGAAAAAGG
AAATTTTTCCCCTTTAGAACTAGACAACGTGCTGTTAAAGAACACTGACTCTATCGAGCTGGCTTTGTCATATGCTAAAA
CTTGGTCAAAATATACTAAGAACATAGTTTCATGGGTTGAAAAAAAGCTTAACTTGGAATTGGAGTCCACTAGAAATATG
GTCAAGTTGGCAGAGGCAACTAGAACTAACATTGGAATTCAGGAGTTCATGCCACTGCAGTCTCTGTTTACTAATGCTCT
TCTTAATGATATAGAAAGCAGTCACCTTTTACAACAAACAATTGCAGCTCTCCAGGCTAACAAATTTGTGCAGCCTCTAC
TTGGAAGGAAAAATGAAATGGAAAAACAAAGGAAAGAAATAAAAGAGCTTTGGAAACAGGAGCAAAATAAAATGCTTGAA
GCAGAGAATGCTCTCAAAAAGGCAAAATTATTATGCATGCAACGTCAAGATGAATATGAGAAAGCAAAGTCTTCCATGTT
TCGTGCAGAAGAGGAGCATCTGTCTTCAAGTGGCGGATTAGCAAAAAATCTCAACAAGCAACTAGAAAAAAAGCGAAGGT
TGGAAGAGGAGGCTCTCCAAAAAGTAACGATCTTTTTCTTTTTTATTTGCAAGTTGAATTAG

Protein (393aa)

>JHU00105
MIAHKQKKTKKKRAWASGQLSTDITTSEMGLKSLSSNSIFDPDYIKELVNDIRKFSHMLLYLKEAIFSDCFKEVIHIRLE
ELLRVLKSIMNKHQNLNSVDLQNAAEMLTAKVKAVNFTEVNEENKNDLFQEVFSSIETLAFTFGNILTNFLMGDVGNDSL
LRLPVSRETKSFENVSVESVDSSSEKGNFSPLELDNVLLKNTDSIELALSYAKTWSKYTKNIVSWVEKKLNLELESTRNM
VKLAEATRTNIGIQEFMPLQSLFTNALLNDIESSHLLQQTIAALQANKFVQPLLGRKNEMEKQRKEIKELWKQEQNKMLE
AENALKKAKLLCMQRQDEYEKAKSSMFRAEEEHLSSSGGLAKNLNKQLEKKRRLEEEALQKVTIFFFFICKLN