Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00102 AK2 ADK2 Homo sapiens Yes Kinases; Metabolism

HuProt v2.0
Block Row Column Clone
22 1 5 JHU00102
22 1 6 JHU00102
HuProt v3.0
Block Row Column Clone
3 1 17 JHU00102
3 2 17 JHU00102
HuProt v3.1
Block Row Column Clone
3 1 17 JHU00102
3 2 17 JHU00102

External Database ID

Nucleotide (720bp)

>JHU00102
ATGGCTCCCAGCGTGCCAGCGGCAGAACCCGAGTATCCTAAAGGCATCCGGGCCGTGCTGCTGGGGCCTCCCGGGGCCGG
TAAAGGGACCCAGGCACCCAGATTGGCTGAAAACTTCTGTGTCTGCCATTTAGCTACTGGGGACATGCTGAGGGCCATGG
TGGCTTCTGGCTCAGAGCTAGGAAAAAAGCTGAAGGCAACTATGGATGCTGGGAAACTGGTGAGTGATGAAATGGTAGTG
GAGCTCATTGAGAAGAATTTGGAGACCCCCTTGTGCAAAAATGGTTTTCTTCTGGATGGCTTCCCTCGGACTGTGAGGCA
GGCAGAAATGCTCGATGACCTCATGGAGAAGAGGAAAGAGAAGCTTGATTCTGTGATTGAATTCAGCATCCCAGACTCTC
TGCTGATCCGAAGAATCACAGGAAGGCTGATTCACCCCAAGAGTGGCCGTTCCTACCACGAGGAGTTCAACCCTCCAAAA
GAGCCCATGAAAGATGACATCACCGGGGAACCCTTGATCCGTCGATCAGATGATAATGAAAAGGCCTTGAAAATCCGCCT
GCAAGCCTACCACACTCAAACCACCCCACTCATAGAGTACTACAGGAAACGGGGGATCCACTCCGCCATCGATGCATCCC
AGACCCCCGATGTCGTGTTCGCAAGCATCCTAGCAGCCTTCTCCAAAGCCACATGTAAAGACTTGGTTATGTTTATCTAG

Protein (239aa)

>JHU00102
MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVV
ELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPK
EPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI