Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00010 AK9 AKD1;AKD2;C6orf199;C6orf224 Homo sapiens Yes Kinases; Metabolism; Nuclear Proteins

HuProt v2.0
Block Row Column Clone
36 1 11 JHU00010
36 1 12 JHU00010
13 24 25 JHU00010
13 24 26 JHU00010
HuProt v3.0
Block Row Column Clone
2 5 20 JHU00010
2 6 20 JHU00010
18 43 13 JHU00010
18 44 13 JHU00010
HuProt v3.1
Block Row Column Clone
2 5 20 JHU00010
2 6 20 JHU00010
18 43 13 JHU00010
18 44 13 JHU00010
23 39 1 JHU00010
23 40 1 JHU00010

External Database ID

Nucleotide (1266bp)

>JHU00010
ATGACTTCTCAAGAGAAGACAGAAGAGTATCCTTTTGCAGATATATTTGATGAAGATGAAACTGAAAGGAATTTTTTGTT
GTCCAAACCTGTTTGCTTTGTTGTATTTGGGAAACCAGGTGTTGGGAAAACAACATTAGCCCGTTACATAACACAGGCAT
GGAAATGTATTCGTGTTGAAGCTTTGCCAATTTTAGAAGAACAGATTGCTGCTGAAACCGAATCAGGAGTTATGTTGCAA
TCAATGTTGATCAGCGGTCAAAGCATTCCAGATGAACTTGTCATAAAGCTAATGTTGGAGAAGCTCAACTCCCCAGAAGT
CTGTCACTTTGGTTATATTATCACTGAAATACCATCACTTTCACAGGATGCCATGACTACCTTACAGCAAATAGAATTAA
TTAAAAACTTAAACCTGAAACCTGATGTTATAATCAATATAAAGTGTCCTGACTATGATTTGTGCCAGAGAATTTCTGGG
CAAAGACAGCACAATAATACGGGATACATATACAGTAGAGACCAGTGGGATCCTGAAGTCATTGAGAATCATAGGAAAAA
GAAGAAAGAAGCCCAAAAGGACGGAAAAGGAGAAGAGGAAGAAGAGGAAGAAGAGCAAGAAGAAGAAGAGGCATTTATTG
CCGAAATGCAGATGGTGGCTGAAATTCTTCATCATCTAGTCCAGAGGCCTGAAGATTATTTGGAAAATGTTGAAAACATT
GTTAAGCTTTATAAGGAAACAATTCTCCAAACTTTAGAAGAAGTAATGGCTGAACACAATCCCCAGTATCTCATTGAGCT
AAATGGAAATAAACCAGCAGAGGAGCTCTTTATGATTGTTATGGATCGACTTAAATATCTGAACCTAAAAAGAGCAGCTA
TTCTAACCAAACTTCAGGGTGCAGAGGAAGAAATTAATGACACAATGGAAAATGATGAGCTATTTCGTACTCTTGCATCT
TATAAACTTATTGCACCAAGATACAGATGGCAAAGAAGTAAATGGGGACGTACATGTCCTGTGAATTTAAAAGATGGTAA
CATTTATTCAGGATTACCAGATTATTCTGTGAGTTTTCTAGGTAAAATCTACTGTCTTTCATCAGAAGAAGCATTAAAAC
CATTTTTGTTGAACCCACGTCCCTATCTGCTTCCACCTATGCCAGGACCACCATGTAAAGTATTCATACTTGGACCTCAA
TATTCAGGGAAAACAACACTTTGCAATATGCTTGCAGAAAATTACAAAGGAAAGGTGACTAACTAG

Protein (421aa)

>JHU00010
MTSQEKTEEYPFADIFDEDETERNFLLSKPVCFVVFGKPGVGKTTLARYITQAWKCIRVEALPILEEQIAAETESGVMLQ
SMLISGQSIPDELVIKLMLEKLNSPEVCHFGYIITEIPSLSQDAMTTLQQIELIKNLNLKPDVIINIKCPDYDLCQRISG
QRQHNNTGYIYSRDQWDPEVIENHRKKKKEAQKDGKGEEEEEEEEQEEEEAFIAEMQMVAEILHHLVQRPEDYLENVENI
VKLYKETILQTLEEVMAEHNPQYLIELNGNKPAEELFMIVMDRLKYLNLKRAAILTKLQGAEEEINDTMENDELFRTLAS
YKLIAPRYRWQRSKWGRTCPVNLKDGNIYSGLPDYSVSFLGKIYCLSSEEALKPFLLNPRPYLLPPMPGPPCKVFILGPQ
YSGKTTLCNMLAENYKGKVTN