Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00001 FGGY Homo sapiens Yes Kinases

HuProt v2.0
Block Row Column Clone
2 1 9 JHU00001
2 1 10 JHU00001
HuProt v3.0
Block Row Column Clone
2 1 5 JHU00001
2 2 5 JHU00001
HuProt v3.1
Block Row Column Clone
2 1 5 JHU00001
2 2 5 JHU00001

External Database ID

Nucleotide (759bp)

>JHU00001
ATGGGGATCAGCAAAGACCCGATTTTTGTACCAGGCGTCTGGGGGCCTTATTTCTCAGCCATGGTACCTGGGTTCTGGCT
GAATGAAGGTGGTCAGAGCGTTACTGGAAAATTGATAGACCACATGGTACAAGGCCATGCTGCTTTTCCAGAACTACAAG
TAAAGGCCACAGCCAGATGCCAGAGTATATATGCATATTTGAACAGTCACCTGGATCTGATTAAGAAGGCTCAGCCTGTG
GGTTTCCTTACTGTTGATTTACATGTTTGGCCAGATTTCCATGGCAACCGGTCTCCCTTAGCAGATCTGACACTAAAGGG
CATGGTCACCGGATTGAAACTGTCTCAGGACCTTGATGATCTTGCCATTCTCTACCTGGCCACAGTTCAAGCCATTGCTT
TGGGGACTCGCTTCATTATAGAAGCCATGGAGGCAGCAGGGCACTCAATCAGTACTCTTTTCCTATGTGGAGGCCTCAGC
AAGAATCCCCTTTTTGTGCAAATGCATGCGGACATTACTGGCATGCCTGTGGTCCTGTCGCAAGAGGTGGAGTCCGTTCT
TGTGGGTGCTGCTGTTCTGGGTGCCTGTGCCTCAGGGGATTTCGCTTCTGTACAGGAAGCAATGGCAAAAATGAGCAAAG
TTGGGAAAGTTGTGTTCCCGAGACTACAGGATAAAAAATACTATGATAAGAAATACCAAGTATTCCTGAAGCTGGTTGAA
CACCAGAAGGAGTATTTGGCGATCATGAATGATGACTAG

Protein (252aa)

>JHU00001
MGISKDPIFVPGVWGPYFSAMVPGFWLNEGGQSVTGKLIDHMVQGHAAFPELQVKATARCQSIYAYLNSHLDLIKKAQPV
GFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLKLSQDLDDLAILYLATVQAIALGTRFIIEAMEAAGHSISTLFLCGGLS
KNPLFVQMHADITGMPVVLSQEVESVLVGAAVLGACASGDFASVQEAMAKMSKVGKVVFPRLQDKKYYDKKYQVFLKLVE
HQKEYLAIMNDD